KEGG   Gossypium arboreum: 108451833Help
Entry
108451833         CDS       T05776                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1
Organism
gab  Gossypium arboreum
Brite
Enzymes [BR:gab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108451833
Protein kinases [BR:gab01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108451833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase S_locus_glycop PAN_2 DUF3403 APH DUF3660 B_lectin Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 108451833
NCBI-ProteinID: XP_017605012
Position
10
AA seq 660 aa AA seqDB search
MKLGWNKKTGLNRHLTSWKSSDDPSPGEYTYSVDPRGLPQLVLRKGSDEQFRSGPWYGTQ
FSGVPVLKVNPVFTPIFVSNADEVYYSYNITANIPSRFVLSQSGSVQHLSWNDRHSNWYL
IFTVQEDRCDNYDLCGSYGICNINRTPNCDCLKGFEPKSSNDWDVLDWSGGCVRKDPHIC
HEGEGFVKFTGLKLPDASQFRVNVSMTIGDCEAECLKNCSCVAYAKLDIRGTGNGCVTWY
EDLIDIRQVPQYGQDLYIRMAASALEKKADTSNNRKNVTIATTISVASAMIILVLIGWFV
SWKQKMIRTQQPENQLTISKVETEEDLELPLFEFATIQAATNNFSPANKIGEGGYGPVFK
GEIPTGQEVAVKRLAENSGQGLQEFKNEVLLISNLQHRNLVKLLGCCIEREERMLVYEYM
PNRSLDSLIFDESRRSSLDWRRRYDIIVGIARGLLYLHRDSRLRIIHRDLKASNVLLDNE
MNPKISDFGMARTFCGDQTEANTKRIVGTYGYMPPEYAIDGHFSLKSDVFSFGVILLEMV
SGKKNRGFFHSTHKLNLLGHAWKLWNEGKALELMDELMEQDFVEEEALRCIQVGLLCVQQ
RPEDRPVMQTVVLMLDSESMSLSQPGRPGFYAERCLSETDSSSLGNLISNEMTVTLLEGR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttggttggaacaagaaaaccggtctcaatagacatcttacttcatggaaaagt
tcggacgatccttctcctggagaatatacttatagcgtggatcctcgtggacttcctcaa
ctcgtccttcgcaagggttccgacgagcagttccggagtggaccgtggtatggaacacag
tttagtggtgtgccagttttgaaggtaaacccagtttttactccaatatttgtctccaac
gccgatgaagtctattattcatataacataacagccaacatcccatcgaggttcgtgttg
agtcaatctggatcggttcaacacctttcctggaatgatcgccactctaactggtacctc
atattcactgtccaagaagatagatgtgataactacgacttgtgtggtagttacggtatt
tgcaacattaacaggactcctaactgtgactgcttgaagggctttgagcccaaatcgtcc
aacgactgggatgtccttgactggtctggcggatgtgtacgaaaagatccacatatatgc
catgaaggagaagggtttgtgaaattcacagggctgaaactaccggatgcttcgcagttt
agggtgaatgtaagtatgacaatcggagattgcgaggcggagtgcctgaagaattgttct
tgcgttgcttatgctaaattagacattagaggcacagggaatggttgtgtaacctggtat
gaagacctaattgatattagacaagttcctcaatatggacaagatctttacataagaatg
gcagcttccgcacttgaaaaaaaggctgatacaagcaacaataggaagaatgtgactatt
gcaacaactatatcagtggcttcagcaatgataatcttggttttgattggttggtttgtg
agttggaagcaaaagatgattagaactcaacagccagaaaatcaactgaccattagcaag
gttgaaactgaggaggatcttgagctccccttatttgaatttgccaccattcaagctgct
actaataacttttcgccagcaaacaagattggagaaggtggatatggaccagtattcaag
ggtgagataccgaccggacaagaagtggcagtgaaaagacttgccgagaattctggacaa
ggccttcaagagttcaaaaatgaggtccttttgatctccaatcttcaacatagaaatctg
gtgaagctactaggctgttgcattgaaagggaagagagaatgttagtctatgagtacatg
ccaaatagaagcttggattccttaatctttgatgaatcaaggcggtcttcacttgactgg
agaaggagatatgacatcattgttgggatagctcgtgggcttctttatcttcatagagac
tcaagactgaggatcattcatagggacctaaaggccagcaatgtcctgttggacaatgag
atgaatcccaaaatttcagactttggaatggcgagaacgttctgcggggatcaaaccgaa
gcaaatacaaagaggatagttggaacctatggttatatgcctccagagtatgcaatagat
ggacacttttctttgaaatctgacgtcttcagctttggagtcatattgttggagatggtg
agtggaaagaagaaccgggggttttttcattccacccacaaactcaaccttctggggcat
gcctggaagttgtggaatgaagggaaggccctggaattaatggatgaattgatggaacaa
gattttgtagaagaggaagcactaagatgcatacaggtgggactcctttgtgtccagcag
aggccagaagacaggccagtgatgcaaacggtagtgttgatgttggatagtgagagtatg
tcattgtctcaacctggaagacctgggttttatgcagaaaggtgtctttcggagacggat
tcatcgtctcttgggaatctaatttccaatgagatgactgttaccttattagagggtcgt
tag

DBGET integrated database retrieval system