KEGG   Gossypium arboreum: 108451935Help
Entry
108451935         CDS       T05776                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP71 isoform X1
  KO
K12736  peptidylprolyl isomerase domain and WD repeat-containing protein 1 [EC:5.2.1.8]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gab03041]
    108451935
   03110 Chaperones and folding catalysts [BR:gab03110]
    108451935
Enzymes [BR:gab01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     108451935
Spliceosome [BR:gab03041]
 Complex C
  Other components
   PPlases
    108451935
Chaperones and folding catalysts [BR:gab03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    108451935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase WD40
Motif
Other DBs
NCBI-GeneID: 108451935
NCBI-ProteinID: XP_017605136
Position
1
AA seq 621 aa AA seqDB search
MEEPQNGNEKLNTIAEEEEEPVIGPGPAPRARPKRPLQFEQAYLDSLPSANMYEKSYMHR
DVVTHVAVSSADFFITGSVDGHLKFWKKKAVGIEFAKHFRSHLDPIEGLAVSADGLLCCT
ISSDRSVKVYDVVNYDMMVMIRLPYVPGAVEWVYKQGDVKAKLAISDRNSSLVHIYDARA
GSNEPIISREIHLGPVKVMRYNSAFDIVISGDEKGIIEYWSPATLQFPESEVNFRLKSDT
NLFEIAKCKTTISAIEVSPDGKQFSITSPDRRIRVFWFRTGKLRRVYDESLEVAQDLQRS
DAPMYRLEAIDFGRRMAVEKEIEKTETAPQPNAVFDESSNFLIYATLLGIKMVNLHTNKV
ARILGKVESNDRFLRIALYQGDRSSKKVRKIPAAAANVNESKDPLTDPTLLCCAFKKHRI
YLFSRREPEEPEDATKGRDVFNEKPPADELLAVSDIGKAVTTSLPDNVILHTTMGDIHMR
LYPEECPKTVENFTTHCRNGYYDNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEF
HKSLRHDRPFTVSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVVKGMDVVQGIEKVK
TDKADKPYQDVKILNVTVPKS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacctcaaaacggaaacgaaaagttaaatactatcgcagaggaagaggaggag
ccggttataggaccaggacccgcccctcgagctcgacccaagcgcccgctccaatttgaa
caagcatatctcgattcccttccttcagctaacatgtatgagaaaagctatatgcatcga
gatgtagttactcatgttgctgtatcgtccgcagattttttcatcactggaagtgttgat
gggcatttgaaattttggaagaagaaagcggttgggattgagtttgcaaagcattttaga
tcccacctggatcccattgaaggtctagcggttagtgcagatggtttactttgctgtaca
atttctagtgaccgctctgtaaaggtatatgatgtggtcaactatgacatgatggttatg
attcgcctaccttatgttcctggtgctgttgaatgggtctacaagcaaggcgatgtcaaa
gctaagcttgccattagtgatagaaattcatcattggtccatatatatgatgcacgagct
ggttcaaacgaacccatcatttctagagagatacacctggggcccgtgaaagtaatgagg
tacaattctgcatttgacattgtaatatctggtgatgagaaaggaattattgagtactgg
agccctgccacacttcagtttccagaaagcgaggtgaattttagattgaaaagtgatact
aatctctttgaaattgcaaaatgcaagacaactatttctgcaattgaggtcagcccggat
ggtaagcaattttctattacatcgcctgatcgcaggatacgtgtgttttggttcagaact
ggtaaattaaggcgagtttatgatgaatcacttgaggtagctcaagatcttcagagaagt
gatgctcccatgtatcggctggaagctatcgactttggcagaagaatggctgttgagaag
gaaattgagaaaactgaaactgcacctcaaccgaatgcagtttttgatgaaagctctaat
ttcctcatatatgctacacttctggggataaaaatggttaatttacacaccaataaagtt
gctcgaatacttggaaaggttgagagtaatgacagattcttgagaattgcattatatcaa
ggtgatcgaagcagcaagaaagtgagaaaaattcctgctgctgcagcaaatgtcaatgaa
agtaaagacccattaacagatccaactctcttgtgttgtgctttcaagaagcataggatc
tatctattcagtcgacgagagccagaagaacctgaagatgccacaaaaggaagggatgtc
ttcaatgaaaagccacctgctgatgagcttctggctgtatctgatattggaaaagcagtt
acaacttctcttcctgacaatgtgatactgcacaccacgatgggcgacattcacatgaga
ctctacccagaagaatgtccaaaaactgtggagaactttactacacactgtcggaatggc
tattatgataatctaatctttcaccgtgtcatcaaaggattcatgatacaaacaggagat
ccattgggagatggcactggtgggcagtctatttggggaagggaatttgaggatgagttt
cataaaagtttacgacatgacaggcctttcacagtgtcgatggctaatgctggccccaat
acgaatggctcacagttctttataaccacagtggctactccatggttggacaataagcat
acggtatttggtagagttgttaagggaatggatgtggtgcagggtattgagaaagtgaag
acagacaaagctgacaagccatatcaagatgttaaaatcttaaatgtgactgtgccaaag
tcttaa

DBGET integrated database retrieval system