KEGG   Gossypium arboreum: 108453277Help
Entry
108453277         CDS       T05776                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
gab  Gossypium arboreum
Pathway
gab00071  Fatty acid degradation
gab00410  beta-Alanine metabolism
gab00592  alpha-Linolenic acid metabolism
gab00640  Propanoate metabolism
gab01040  Biosynthesis of unsaturated fatty acids
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
gab01200  Carbon metabolism
gab01212  Fatty acid metabolism
gab04146  Peroxisome
Module
gab_M00087  beta-Oxidation
gab_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    108453277
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108453277
   00592 alpha-Linolenic acid metabolism
    108453277
   01040 Biosynthesis of unsaturated fatty acids
    108453277
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108453277
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108453277
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     108453277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 108453277
NCBI-ProteinID: XP_017606777
UniProt: A0A0B0PZ82
Position
10
AA seq 438 aa AA seqDB search
MTVHSQIQDETGRSVKPSYFNSPPLDVSVAFPQATPASTFPPLASDYYQFDDLLSPEERA
LRKKVRECMEKEVAPIMAEYWEKAEFPFQIVPKLGALRISGGTIKGYGCPGLSLTGSAIA
MAEVARVDASCSTFILVHSSLAMLTIALCGSEEQKQKYLPSLAQLKTVACWALTEPDYGS
DASSLKTTATKVDGGWVLEGQKRWIGNSTFADVLVIFARNTTTNQINGYLVKKDSPGLTA
TKIPNKIGLRIVQNGDILLKKVFVPDEDRLPGVNSFQDTSKVLAVSRVMVAWQPIGISMG
VYDMCARYLKERKQFGAPLAAFQINQQKLARMLGNIQAMTLVGWRLCKLYEEGKMTPGHA
SLGKSWITSMARETAALGRELLGGNGILADFLVAKAFCDLEPIYTYEGTYDINSLVTGRE
ITGFASFKPASVSQRSRL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcactcccagattcaagatgaaactggcagaagtgtcaagccgtcttatttt
aactcaccacctttggacgtttcggtcgcattccctcaggcaactccagcatctactttt
cctcctcttgcttccgactattatcaatttgacgatctattgagtcctgaggagcgggct
ctacgtaagaaagtaagagagtgtatggaaaaagaagtagctcctataatggcagagtac
tgggagaaggcagagtttccattccaaattgttcccaaacttggtgctcttcgtatttct
ggtggtactatcaagggttatggatgcccaggtctctccctcactggaagtgctattgca
atggcagaggttgctagggtcgatgcaagttgctcgacttttatcttggtgcactcatct
ctagccatgcttaccattgcattatgtgggtcagaggaacagaagcagaagtatttacca
tcattggcacagttaaaaactgtagcttgttgggctttgactgagcctgactatggaagt
gatgctagttctctgaagacaactgcaacaaaggtagacggaggctgggtacttgaggga
caaaaacgctggataggaaacagtacttttgcagatgtgttggttatctttgccaggaat
actacaaccaaccagataaacggatatttagttaagaaagattcccctggattgacagct
acaaaaataccaaacaagattggattgcgaattgttcaaaatggagatattctcttaaag
aaagtctttgttccggatgaggacagattacctggtgtgaactcttttcaggatacaagc
aaggtacttgctgtttctcgagtaatggttgcatggcaacctatcggtatatcgatgggt
gtctatgatatgtgtgccaggtacctgaaggagaggaaacagtttggagctccattggca
gccttccaaattaaccagcagaaacttgctcgcatgttgggtaatattcaagcaatgacc
cttgttggttggcgcctttgcaaattgtatgaagagggtaaaatgactcccggtcatgcc
agcttgggaaagtcgtggattacctcaatggcaagagagacagctgctcttgggcgggag
ttacttggtggcaatggaattttggccgattttcttgttgcaaaggcattctgtgatttg
gaacccatttacacatacgaaggcacgtatgacatcaacagcttggtaactggtagggaa
atcactggttttgccagttttaagccagcctcagtgagccagcgaagccgcctatga

DBGET integrated database retrieval system