KEGG   Gossypium arboreum: 108453333Help
Entry
108453333         CDS       T05776                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
gab  Gossypium arboreum
Pathway
gab03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gab00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108453333
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gab03041]
    108453333
Enzymes [BR:gab01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     108453333
Spliceosome [BR:gab03041]
 Complex C
  Other components
   Step II factors
    108453333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_30 AAA_19 T2SSE AAA Sigma54_activ_2 ABC_tran AAA_16 PhoH Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 108453333
NCBI-ProteinID: XP_017606859
Position
10
AA seq 1189 aa AA seqDB search
MASSPAQDDALKKLEYLSLVSKVSSELESHVGFSDKVLAEFITDMGRHSETVDEFDVKLK
ENGAELPDYFVRTLLTIIHAILPPKPKAEKEYKKAIAGDGKKSKFKALAIADDKDRAKEL
EKEIEMETRDLKKVEGRDRDRGRDRYRRDSDRVRERDRDKDRSRHRDRYTEDADDDRMDY
GSRGRNRDRTRHNRDGDEDNRDYRNRGRIRDRGNVEGDEGGDKRSNGRYKDNEPELYKVY
KGRVSRVMDSGCFVQLNELRGKEGLVHVSQMASRRIANAKDVVKRDQDVYVKVISVSGQK
LSLSMRDVDQNTGKDLLPLKKTSDDDALRINPSGGKEWPVMRTGLSGIRIVEDEDTAPSR
RPLKRMSSPERWEAKQLIASGVLRLDEYPMYDEDGDGMLYEEEGAEEELEIEMNEDEPAF
LQGQTRYSVDLSPVKIFKNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRP
WEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAYGKALTFGQRSKLSIQEQRQSLPIYK
LKKELVQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTKGKIGCTQPRRVAAMSVAKR
VAEEFGCRLGEEVGYAIRFEDCTGPETVIKYMTDGMLLREILIDEDLSQYSVIMLDEAHE
RTIHTDVLFGLLKQLLRRRADLRLIVTSATLDAEKFSGYFFDCSIFSIPGRTFPVEILYT
KQPESDYLDAALITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYERMKGLGKNVPELII
LPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVVDPGFAKQNVYNPKQ
GLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGMTT
LTMKAMGINDLLSFDFMDPPAPQALLSAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPL
SKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVY
EAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFMKIRKAITA
GFFFHAARKDPQEGYRTVVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVID
PKWLVELAPRFFKQADPSKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatctcctgcccaagacgatgcgctgaagaaacttgaatacctctccctcgtc
tccaaggtcagctccgaactcgagagccatgtagggttttccgataaggttttggccgaa
ttcatcaccgacatgggccgccactccgagaccgttgacgaattcgatgtcaagctgaaa
gaaaacggtgccgagttacctgattacttcgtccgtacacttcttactatcatccacgct
attctgcctccaaaacccaaggctgagaaggaatacaagaaggcaatcgccggtgacggt
aagaaatctaaatttaaagctttagcgattgcagatgataaagatagagcaaaagaactt
gagaaggaaattgaaatggagacacgagacctaaaaaaagtagagggtagggatagggac
agaggcagagacagatataggagggatagcgatagggtcagagagagagatagagataaa
gataggagtaggcatagagatagatatacggaggatgctgatgatgataggatggattat
ggcagtcggggaagaaatagggatcgaacccgacataatagagatggtgatgaggataat
agggattataggaataggggcaggatcagggaccggggtaatgtggaaggtgatgaaggt
ggggataagaggagtaatggaaggtacaaggataatgagcctgagttgtataaggtatac
aaggggagagtttcaagagtgatggattcaggttgttttgtgcagttgaatgagttaagg
ggaaaggagggtttggttcatgtttcccagatggctagtaggaggattgccaatgcaaaa
gatgttgtgaaacgggatcaggacgtttatgtgaaggtaatttcagtttcaggtcagaag
ttgagtttgtctatgagggatgttgatcagaatactggtaaggacttgcttccgttgaag
aaaacttcagatgatgatgctcttaggattaatccttcaggggggaaagagtggcccgtg
atgagaactggcctttcagggattaggattgttgaggatgaggatactgccccttcacgt
aggccattgaagagaatgagttcgccagagaggtgggaagccaaacaattgattgcttct
ggtgttctgagactagatgaatatcccatgtatgatgaagatggagatggaatgctttat
gaagaggaaggtgctgaggaagaacttgagatcgaaatgaatgaggatgaacctgccttt
ttgcaagggcagactaggtactctgtggatctctcaccagtaaaaatatttaagaatcca
gaagggtccttgagtcgcgctgctgctctccagtctgcacttattaaggaacggcgagaa
gttcgggagcagcagcagaggacaatgcttgattcaattcccaaggatcttaatcgtcct
tgggaagacccaatgccagagacaggtgagaggcatcttgcgcaggagcttagaggtgtt
ggattgtcagcatatgatatgcctgaatggaagaaggatgcttatggtaaagctttgact
tttgggcagaggtctaaactttccatccaagagcagaggcagagcttgcccatttataaa
ttgaaaaaagagcttgttcaggctgtgcatgataatcaggtactcgtggtcattggtgag
actggttcaggtaagactacccaggtaacccagtatcttgctgaggctgggtacactaca
aagggtaagattggatgcactcaacctcgaagggtggctgcaatgtctgtggcgaagagg
gtagctgaggaatttggttgtcggctaggggaggaagttggctatgctattcgttttgaa
gattgcactggaccggagactgtcataaaatacatgactgatggtatgcttcttagggag
attttgattgacgaggatctctctcagtactctgtcattatgcttgatgaagctcatgag
cgaacgattcacactgatgtcctttttgggttactgaagcaacttctgagacggagagcc
gatcttcgtctgattgttacgtctgctacactggatgcagagaagttttcagggtatttc
tttgactgcagtattttcagcattcccggtagaacatttcctgtagagatactctataca
aaacagcctgaaagtgactacttagatgccgctcttataacagtcctacagatacacttg
actgaacctgaaggtgacattcttctcttcttgactggtcaggaggaaattgattttgca
tgccagtctctttatgagaggatgaaaggacttggtaaaaatgttcctgaattgattatt
ttaccggtttatagtgcccttcctagtgagatgcagtctaggatttttgatcctgcccct
cctgggaaaaggaaggtggtagtggcaaccaatattgctgaggcttctttaactatagat
ggaatattctatgtggttgatcctggttttgcaaaacaaaatgtctacaatccgaagcaa
gggcttgattccctggtcataacaccaatttcacaagcatcggccaaacaacgtgctggg
cgggctgggcgtactggacctggaaaatgctaccgcttgtatactgagagtgcatatcga
aatgagatgtcccctacatcgattccagagatccaaaggattaaccttggcatgacaaca
ctaacaatgaaagcaatgggcataaatgatctcctttcttttgattttatggatccacct
gcaccacaagctctcctttctgccatggagcaattatacagtttaggagctttagatgag
gaggggcttttgactaaattgggtagaaaaatggcagaatttcctcttgatccaccacta
tcgaagatgttactggctagtgtggacctcgggtgtagtgatgagatattgacaattatt
gcaatgatccaaactggtaacatcttctacaggccaagggaaaagcaagctcaagctgat
cagaagagggccaagtttttccagcctgagggagaccatttgactctacttgctgtatat
gaggcttggaaagctaagaacttttctgggccttggtgttttgaaaattttgttcagtct
cgatctttacggagggcacaggatgttagaaaacagcttctaagcatcatggataagtac
aaactggacgtagtgagtgcaggaaagaactttatgaagatcaggaaagctatcacagca
gggttcttcttccatgctgcaaggaaggacccacaggaaggatatagaacagtggtggag
aaccagcctgtttatattcacccaagtagcgcccttttccagagacaaccggactgggtg
atctaccatgagctggtaatgactacaaaggagtacatgcgagaggtgacagtgatagat
cccaaatggctggttgaacttgcgcctagattcttcaaacaggcagatcccagcaagatg
agcaagcgcaagcgtcaagaacgtattgagcctctttatgatagatatcatgaacctaat
tcttggcgtctcagtaaacgacgagcttga

DBGET integrated database retrieval system