KEGG   Gossypium arboreum: 108456360Help
Entry
108456360         CDS       T05776                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED6, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
gab  Gossypium arboreum
Pathway
gab00906  Carotenoid biosynthesis
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
Module
gab_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    108456360
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     108456360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 108456360
NCBI-ProteinID: XP_017610442
Position
11
AA seq 608 aa AA seqDB search
MIFSSTMQPSLHFFTPKHQSLLQTQSQLFTCKFIVNPAKKTVPRNPLPLLSPPAQSRSSP
HPEVVEPMVQRERSNVLVPQHPNYPVHLNRFQKLAAVALDKIETSVIMRLEKNHVLPKMV
DPAVQISGNFAPVEECPVHHGLEVVGPIPACLRGVYVRNGANPMFAPSGGHHLFDGDGMI
HAVSLGLGNKASYSCRYTRTSRLVQEARFGRCMFPKPIGELHGHLGLARLGLYMARACLG
LVDGSHGTGVANAGLVYFNGRLLAMSEDDLPYHVKITGDADLETIGRFNFNDQIDCPLIA
HPKLDPVTGDLHTLNYNVLKKPYLKYFRFDKFGRKSRDLRVDIDQATMIHDFAITENFVV
IPDHQMVFKLSEMIQGGSPVVYNKNKTSRFGVLQQNDVVGSGIQWINVRNCFCFHLWNAW
EEISDTGDKIIVVIGSCMNPPDSIFNESKDTFRSELSEFRMNLRTRQSTQRVIVPGMNLE
AGQVNGQYLGQKTRFVYLAIADPWPKCSGIAKVDLQTGKVTKFMYGTWRYGGEPFFVPEK
KQTCNRNGNEDEGYIMGFVRDEKKEMSEMVIVQGSSMEQVAAISLPSRVPYGFHGTFISQ
EELRRQVI
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgatcttctcttccaccatgcaaccctcacttcacttctttacccccaaacatcaatct
ctccttcaaacccaatcccaattatttacatgcaagtttatcgtcaatcccgccaagaaa
accgttcctcgaaatccgttaccattgctatcaccgccggcgcagtcacgatcatctccg
catcccgaggttgttgaacctatggtccaacgagaacgtagtaatgtcttggttccacaa
cacccgaactatccggttcatttaaaccggtttcaaaagctagcggcggtggctttggac
aaaattgagacctccgtgatcatgcgacttgaaaaaaatcatgtgttgcctaaaatggtt
gacccggcggttcaaatttcagggaactttgcaccggttgaagagtgtccggtccatcac
gggttggaagtggtcggtccgattccagcttgcttacgcggcgtatacgtccgaaacggt
gcaaaccctatgtttgcaccctcaggtgggcaccatttgtttgacggtgatgggatgatc
catgccgttagcttggggcttggaaataaagctagttatagttgcaggtatactcgaacc
agccgattggttcaagaagcccggttcggtcggtgcatgttccccaaaccaattggtgag
ctgcatggacacttgggtttagctagactcggtctgtacatggctcgagcctgtttaggc
ttagttgacggttcacacggcacgggtgtagcaaatgcagggcttgtttatttcaatggt
agactgttagccatgtccgaagatgatcttccttatcacgttaaaatcaccggcgacgcc
gatcttgagacgattggacggttcaacttcaatgatcaaatcgattgcccgttgatcgct
cacccaaaactagacccagtcacaggtgatttgcacaccctgaattacaacgttctaaag
aaaccttacttgaaatacttcaggttcgataaatttggaaggaagtcacgtgacttgcgg
gtggacatcgaccaggcaacaatgattcacgactttgccataaccgagaatttcgtagta
atcccggatcaccaaatggtattcaagttatccgaaatgattcagggcggatcacccgtt
gtatacaacaaaaacaagacatcccgattcggtgtcttgcaacaaaacgatgttgtcggg
tcggggatccaatggatcaacgtacggaattgcttctgtttccatttatggaatgcatgg
gaagaaatatccgacaccggtgataaaatcatagtagtaatcgggtcctgcatgaacccg
cccgattccattttcaacgaatcaaaagacacgttccgaagtgaactatccgaattccga
atgaacttaagaacaagacagtcaacacaaagggtaattgtaccaggaatgaacctggaa
gcgggtcaagtgaacggacaatacctgggtcaaaagacccggttcgtgtatttggcaata
gcggatccatggccaaagtgttcgggcatagcaaaagtagatttgcagacaggtaaagtc
accaagttcatgtacggaacatggcgttatgggggtgaaccattttttgtgcccgaaaaa
aaacaaacgtgtaacagaaacggtaatgaagatgaaggatatataatgggattcgtgaga
gatgagaagaaggaaatgtcggagatggtgatagtgcaaggttcgagcatggaacaagtg
gctgctataagtttgcctagtagggttccttatgggttccatggcacctttattagtcaa
gaagagctacgtcgtcaagtcatctga

DBGET integrated database retrieval system