KEGG   Gossypium arboreum: 108456902Help
Entry
108456902         CDS       T05776                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
gab  Gossypium arboreum
Pathway
gab03040  Spliceosome
gab04141  Protein processing in endoplasmic reticulum
gab04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gab00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108456902
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108456902
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108456902
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gab01009]
    108456902
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gab03041]
    108456902
   03009 Ribosome biogenesis [BR:gab03009]
    108456902
   03110 Chaperones and folding catalysts [BR:gab03110]
    108456902
   04131 Membrane trafficking [BR:gab04131]
    108456902
   03051 Proteasome [BR:gab03051]
    108456902
   03029 Mitochondrial biogenesis [BR:gab03029]
    108456902
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gab04147]
    108456902
Protein phosphatases and associated proteins [BR:gab01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108456902
Spliceosome [BR:gab03041]
 Complex B
  Other components
   Prp19 complex
    108456902
 Complex C
   Prp19-CDC5 complex
    108456902
Ribosome biogenesis [BR:gab03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108456902
Chaperones and folding catalysts [BR:gab03110]
 Heat shock proteins
  HSP70 / DNAK
   108456902
Membrane trafficking [BR:gab04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108456902
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108456902
Proteasome [BR:gab03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108456902
Mitochondrial biogenesis [BR:gab03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108456902
Exosome [BR:gab04147]
 Exosomal proteins
  Proteins found in most exosomes
   108456902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 108456902
NCBI-ProteinID: XP_017611127
Position
11
AA seq 646 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
QVAMNPLNTVFDAKRLIGRRFSDAAVQSDIKLWPFKVIPGSGDKPMIVVSYKGEEKQFAA
EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVDAKNALENYAYNMRNTVKDEKIGAKLAAADKKKIEDAIDEAIQWLDNNQLAEADEFED
KMKELESICNPIIAKMYQGAGADMGGMDEDAPASGTGAGPKIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaaaggagaaggtccagcgattgggattgatctcggaacaacttattcttgc
gttggcgtttggcaacatgatcgtgttgagatcatcgccaacgatcaaggtaacaggacc
acgccgtcttatgttggctttactgataccgagcgtttgatcggtgatgcggcaaagaac
caggtcgccatgaaccccttgaacaccgtctttgatgcaaagaggttgattggtcgtaga
ttcagcgatgccgctgttcagagtgatattaaattgtggccattcaaggtcataccagga
tctggtgataaaccgatgattgtagtttcttacaaaggtgaggagaagcaatttgccgct
gaggagatctcgtctatggtcctcataaagatgcgtgagattgccgaggcttaccttggc
tttacggttaagaatgccgtggttactgtccctgcatactttaatgactctcagcgtcag
gctacaaaggatgctggtgtcattgctggtcttaatgtcatgcgtattattaatgagccc
actgctgctgccattgcgtacggtctagacaagaaggctaccagcgttggtgaaaagaat
gtattgatctttgatcttggtggtgggacttttgatgtctctcttcttaccatcgaagag
ggtatctttgaggtgaaggccactgctggagacactcaccttggaggtgaagattttgat
aatagaatggtgaaccatttcgtgcaagagttcaagagaaaaaacaagaaggacattagt
ggcaaccccagagctcttaggaggttgaggacttcttgtgagagggcaaagagaactctt
tcatccactgcccaaaccaccattgaaattgattccctgtacgagggtattgacttctac
tcaaccattacccgtgccagatttgaggaacttaacatggatctattcagaaaatgtatg
gaaccagttgagaagtgtttgagggatgccaagatggacaaaagcagcgtccatgatgtc
gtgcttgttggtggttctactagaattcccaaggttcagcaacttttgcaagatttcttc
aacgggaaggagctctgcaagagcatcaacccagatgaagctgttgcttacggtgctgcg
gttcaagccgctatcttgagtggcgagggtaatgagaaggtgcaggatctgttgctcttg
gatgtcaccccactgtctctcggtttggaaactgctggcggtgtgatgactgttttgatt
ccgaggaacaccaccattcccaccaagaaggagcaggtcttctctacatactcagacaac
cagcctggtgtgttgatccaggtgtatgaaggtgagagagcaaggacaagagataacaac
ttgcttggtaaatttgagctctctggtatcccaccagctcccagaggtgtcccacagatc
acagtgtgctttgatattgatgccaatggtattttgaatgtgtccgctgaggacaaaacc
actgggcagaagaacaaaatcaccattacaaatgacaagggaaggctttcgaaggaggaa
attgagaaaatggttcaggaagcagagaagtacaagtcagaggacgaagagcacaagaaa
aaggtggatgcaaagaacgcgttggagaactacgcatacaacatgaggaacacagtgaag
gatgagaagattggtgccaaacttgctgcagcagataaaaagaagattgaagatgcaatt
gacgaggccatccaatggttagacaacaaccagcttgcagaggcagatgaatttgaagat
aagatgaaggaattggagagcatctgcaatcccatcattgctaaaatgtaccaaggcgct
ggtgctgacatgggtggcatggatgaggatgccccagccagtggaaccggcgcaggcccc
aaaattgaggaagtggactaa

DBGET integrated database retrieval system