KEGG   Gossypium arboreum: 108460791Help
Entry
108460791         CDS       T05776                                 

Definition
(RefSeq) cysteine--tRNA ligase 2, cytoplasmic-like
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
gab  Gossypium arboreum
Pathway
gab00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gab00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108460791
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gab01007]
    108460791
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gab03016]
    108460791
Enzymes [BR:gab01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     108460791
Amino acid related enzymes [BR:gab01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   108460791
Transfer RNA biogenesis [BR:gab03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    108460791
 Prokaryotic Type
    108460791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 108460791
NCBI-ProteinID: XP_017615932
Position
12
AA seq 546 aa AA seqDB search
MDSSKQETNQKKASKTMAKKEAEEFQFVVYNTMTQQKEVFKPKTPGKVRMYVCGVTAYDF
SHLGHARAAVSFDVLYRYLKHLGYEVTYVRNFTDVDDKIIRRANETGEDPISLSDRYCKE
YNIDMSDLQCLSPTHEPRVSDHMEQIKDMITQIINKDFGYVVDGDVFFAVDKFPNYGKLS
GQKLENNRAGERVAVDSRKRNPSDFALWKAATPGEPSWDSPWGPGRPGWHIECSAMSAHY
LSFKFDIHGGGLDLIFPHHENEIAQSCAACEESDVSYWLHNGHVTNNNEKMSKSLGNFFT
IRQITERYHPLALRYFLINAHYRSPLNYSVVQLEGASDAIFYIYQSLKDCQDALLQLQEE
IPNDGKPARTTPDAKECISKLCNEFQVKMSDDLSTSLILTGAFLEALKLVNNLLTMLKKK
QQKQQRLLVIESLKEIGKEVTKVLDVLGLQPPCSYNEVLLQLKEKALTRAGLVEDDVIRL
INKRAEVRRNKDFLKSDQMRAHLQAKGIALMDVGTETIWRPCVPVQQESEVVPSEGQKVP
PKPETA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggattcttcaaagcaagaaacaaaccagaaaaaagcttctaaaacgatggctaagaag
gaagccgaagaattccaatttgttgtttacaatactatgactcagcaaaaagaggttttc
aagcccaaaacccctggaaaagttcgcatgtatgtctgcggtgtcactgcctatgatttc
agtcaccttggccatgctcgtgctgccgtttccttcgatgtcctttacaggtaccttaag
catttgggttatgaggttacttatgtcaggaattttactgatgttgatgataagataatt
cgtcgagccaatgagactggagaagatccaataagtttgagtgaccggtactgtaaagaa
tataatatagatatgagtgatctacagtgtctttctccaacacatgagccgcgcgtttct
gatcacatggagcagatcaaagatatgataactcagattataaacaaagactttggatat
gttgttgatggcgatgtgttttttgctgttgataaattcccaaattatggcaagttatct
gggcagaaactggaaaacaatagagcgggtgaacgtgttgctgttgactcaaggaagcgt
aatccttccgactttgcattatggaaggctgcaacgccaggtgagccatcttgggacagc
ccatggggacctggacgacctgggtggcacatagaatgtagtgcaatgagtgcacattat
ttaagcttcaaatttgacattcatggtggtgggcttgatttgatttttcctcaccatgaa
aatgaaattgctcaaagttgtgctgcgtgcgaagagagtgacgtaagttattggttgcac
aatgggcatgttactaataacaatgagaagatgtcaaaatctttgggtaactttttcaca
attcgccagattactgagagatatcatccactggctttgcggtacttcttgataaatgca
cactatcgttctcctctcaattactccgttgttcagttggaaggtgcatcagatgctatt
ttttacatatatcagagtttgaaagattgccaagatgctctattacaactacaagaagaa
attcccaatgatggcaaaccagctcggactactccggatgccaaggaatgcattagcaag
ctctgcaatgagttccaggtgaaaatgtcagatgacttgagcacttcacttatactgact
ggagcctttctagaagcgttgaagttggtaaacaatttgttgaccatgctaaagaagaag
cagcaaaagcaacaaagattattggtaattgaatcccttaaagagattgggaaagaagtt
acgaaagttttggatgttcttggattgcagccaccttgctcttataatgaggttttgctg
caattaaaggagaaagcattaacgagagccgggttggtggaagatgatgtgattcgtcta
attaacaaaagagctgaagtgaggagaaacaaagacttcttgaaaagtgatcagatgaga
gctcatttgcaagctaagggcattgcactcatggatgtaggcacggaaacaatttggaga
ccttgtgttcctgttcaacaagaatcggaagtagtgccatcagagggccagaaggtccct
cccaagcctgaaactgcataa

DBGET integrated database retrieval system