KEGG   Gossypium arboreum: 108461302Help
Entry
108461302         CDS       T05776                                 

Definition
(RefSeq) probable protein S-acyltransferase 17
  KO
K20003  palmitoyltransferase ZDHHC4 [EC:2.3.1.225]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gab04131]
    108461302
Enzymes [BR:gab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     108461302
Membrane trafficking [BR:gab04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    108461302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC IGFBP
Motif
Other DBs
NCBI-GeneID: 108461302
NCBI-ProteinID: XP_017616595
UniProt: A0A0B0NSK8
Position
13
AA seq 393 aa AA seqDB search
MSLHWALICHGLITLTIVVSFLCGQWPIFQGTPISSIHRFLTFGAYQYFLRFIGAVFGDR
GTNLILSVEYYCCDRPNPILQLIYLAIIGTTYYIIVKTSFSYIPGYYLSEAHRYASFLAI
AVGILLFLVTSFSDPGTVKADNVSRYLSAYPYDNIIYTEKECPTCKIPKPARSKHCSLCN
RCVARFDHHCGWMNNCIGERNTRYFLAFLLWHFLLCIYGTIAIGLVLAGRLKELQIVHVL
TVYYGVDNSLRSLAPYVVQWLLDAHNTQILLMVFMGVVSLLLAGFFAYHANLCLTNTTTN
ETFKWQDYISWQKKLIEARASTAALKANIAGMTTEGKPQESKCKSFFRRSLLQDTEAIVK
KNVYDKGFFHNLYEVVFPVSTRASFLHTKSKSG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcattgggcattgatatgccatgggttgataactcttacaatagttgtttcc
ttcctttgtgggcagtggcctatcttccaaggaacacccatcagctctatccatcgtttc
ctcactttcggagcttatcaatacttcctgaggtttattggggctgtttttggagataga
ggaacaaatttgatcctttccgttgagtattattgttgtgataggcctaatcctatctta
cagcttatatacttggcaataattggaacgacttattacattatagtgaagacgtctttt
agctatattcctgggtactatctgagtgaagctcataggtacgcaagttttttggctatt
gctgtcggcattctgctctttctagtaactagcttttctgatccggggactgtgaaggct
gataatgtttcacgatatctatctgcttatccttatgacaatatcatctataccgagaaa
gaatgtcccacttgtaaaattccaaaacctgctagatcgaagcactgcagcttatgcaat
cgatgtgttgctcgctttgatcatcactgtggatggatgaataactgtattggggagaga
aatacccgatacttcttggcttttcttttatggcatttccttctttgcatttatgggaca
attgctattggattggttcttgctggacgattgaaagaattgcaaattgtgcatgtttta
acagtttattatggtgtggataattctcttcgcagtttagctccgtatgtcgtacagtgg
ctattagacgcacataacacccagatacttcttatggtgttcatgggtgtagtttctctc
ttattagcgggtttcttcgcatatcacgctaatctttgtctcacgaacacgacaacaaat
gagaccttcaagtggcaagactacataagctggcagaagaaactgattgaagcacgagcg
agtacagcggcactgaaagcgaacatcgccgggatgactactgaaggaaagcctcaagag
agcaaatgtaaatccttcttcagacggtcccttctacaggatactgaagccattgtaaag
aagaatgtgtatgataaagggttctttcacaatctctacgaggtcgttttcccagtttca
acaagagcatcatttttgcatactaaatcgaaatccggctaa

DBGET integrated database retrieval system