KEGG   Gossypium arboreum: 108462174Help
Entry
108462174         CDS       T05776                                 

Definition
(RefSeq) erlin-2
  KO
K23341  erlin
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gab04121]
    108462174
Ubiquitin system [BR:gab04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    108462174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 108462174
NCBI-ProteinID: XP_017617645
Position
13
AA seq 228 aa AA seqDB search
MDPPQDSAAPPSPPAQSGGSFGIPAMLVFASIVIIASPAMVPSCWYTRNSLSILHQVPEG
HVGVYWKGGALLKTITEPGFHLKMPLVTQYEPVLVTLQTDQVRNIPCGTKGGVMINFEKI
EVVNKLKKEYVYETLLNYGVNYDNTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDEKMK
DALQCGCTKYAPGIEILSVRVTKPIIPERIRRNYEQMEEERTKVSITS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggatcctccacaagatagtgcagcaccaccgtctcccccggctcaaagcggcggttct
ttcggaatccccgcaatgcttgtctttgcttccatagttatcatcgcctccccggcaatg
gtgccatcatgttggtatactagaaacagcttatccattttgcatcaagtccctgaaggc
catgttggtgtttattggaagggtggggctcttctaaaaacaataaccgagccaggtttc
catttgaagatgcctcttgtaacccagtatgagcctgttctagttactcttcagacagat
caggtgaggaatattccatgtggtactaaagggggggtaatgattaactttgaaaagata
gaggttgtgaataagcttaaaaaagagtatgtgtatgagacattgctgaactatggtgtt
aattacgataacacgtggatatatgataagattcatcatgagatcaatcaattctgcagc
tctcactctcttcagcaagtatacattgatgtttttgatcagattgatgaaaagatgaaa
gatgcacttcaatgtggttgcacaaagtacgcaccaggaattgaaattcttagtgtaagg
gttacaaagcccattatacctgaaagaattagaagaaattatgaacaaatggaagaagaa
cgcaccaaggtttccatcacttcctaa

DBGET integrated database retrieval system