KEGG   Gossypium arboreum: 108462562Help
Entry
108462562         CDS       T05776                                 

Definition
(RefSeq) wall-associated receptor kinase-like 1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gab01001]
    108462562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind PIP49_C Kinase-like
Motif
Other DBs
NCBI-GeneID: 108462562
NCBI-ProteinID: XP_017617981
Position
13
AA seq 914 aa AA seqDB search
MDTSLVFYFILQLSWLIRAANSDCHETCGNVAIPLPFGIKTGCYNNSWFRVTCNQTVNGP
KPFISRINLELLGKFQPVENAVSVNNPVSYINCGDKGNNGTTASSSVDLTDSPFFFSTEY
NVFGSVGCSNIVYLNNQAADVTSVCLQRRCGDLISKLGGCHASISDYNLVSYTTNITGIE
FSNPRSNRCTSAFIFDSSRLKSSDVDPQFPYNISINTTHVPATLMWYSVLCNSEAAICQK
LKPADNPPPPVQSPTIPLNYKYGCIERCGNIGIPFPLGIEVGCYMNNWFRVTCKETIDGS
RPFISSINLQLLDVSFSERIVLVNNSVVYINCLRETNVVGVNLTGTPFLFSHVFNRFVSV
GCDSLAAFLRSPTDDYPIVWCAQPHCNNMTSEAMCSADIPPNLSSFAAKVTQIYPSIENN
RLCGSAFIVDQRYPDSLERIIPNRNDTSKQARSYFPTTLLWGRHKRGLCKLREGSNITCR
SDGAYCWASLSETHLCVCHLDSYGDSDDVCQGNNCSSSCPAGYEYICKPISPSIMTKDPK
RSQILPIIVGCGASIGTIFVLLGAWQSHKLLQRRNNTKLKQKYFKRNGGLLLQQQLSNNE
GKVEKIKVFTSKELEKATDYYNENRILGQGGQGTVYKGILTDGNIVAIKKSKLVEEKVLD
DKKLKQFINEVIILSQINHRNVVKLLGCCLETKIPLLVYQFIPNGTLYDLLHRPNEEFPL
TWEIRLRIAIEIANALSYLHSAASVPIYHRDIKSSNILLDDKYKAKVSDFGTSISIALEQ
THVTTRVQGTFGYLDPEYFRSNQFTEKSDVYSFGVVLVELITGQKPISSSESEEVVRSLA
NFFLLSMEENALLNVVDPLVMNANAKEEIVAVAKLAKRCLYLNGKKRPTMKQVAMELQAK
GQLSSISRNGQFRV
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggacactagcttggtattttacttcatcctgcagctttcgtggctaatccgagcagcc
aattctgattgtcatgagacatgtgggaatgttgcaattccgttgccatttggaatcaaa
actggttgctataacaattcgtggtttagagtcacttgcaaccaaaccgttaatgggcca
aaacctttcatcagtcgcatcaatctggagttacttggtaaatttcaaccggttgaaaac
gccgtatccgtcaacaatccggtaagttacataaattgcggtgataaaggaaacaatggt
accacagcttcttcaagcgtggaccttacagacagtccatttttcttctcaactgaatac
aacgtattcgggtcagtaggttgcagcaatattgtatatctcaataatcaagctgctgat
gtaaccagtgtctgccttcaacgaagatgtggcgacctgatttctaaattaggtggctgc
catgccagtatttctgattataatcttgtttcctatacaacaaatattacaggtatagag
ttctctaatcctaggagcaatagatgtacatctgctttcatatttgattctagtcggttg
aaatcatcagatgtagatcctcaatttccctacaatataagtattaatacgacgcatgtt
cctgcaacgctgatgtggtattccgtcctatgcaattcggaagctgcgatatgccaaaaa
ttaaaaccagctgacaatccacctcctccagttcaatcaccaactatacctttaaattac
aagtatggatgcattgaaagatgtgggaatattggtattccattcccattgggaattgaa
gtgggatgttacatgaataactggttcagagtaacttgcaaagaaacaattgatgggtca
aggcctttcataagtagcatcaatctgcaattattggatgtgtcattttccgaacgcata
gttctcgttaacaattcggtagtttatatcaattgtctcagagaaactaatgtggttggt
gtcaacctaacaggcaccccctttctattctcacatgtcttcaacagatttgtgtctgta
ggttgcgatagtttggcggcttttcttcgtagtccaacggatgattatcctattgtttgg
tgtgcgcaaccacattgtaacaacatgacttccgaagctatgtgctctgcagatattcct
ccgaatctcagttcctttgctgcaaaagtgacacagatttatcctagtattgaaaacaat
agattatgtggatctgctttcattgttgatcaacgttaccctgattcactagagagaata
attccaaaccgcaatgacacaagtaagcaggctcggtcatacttccccacaacactgcta
tggggcagacataaacgtgggctgtgtaagttgagagaaggttcaaacatcacgtgtcgc
tctgatggtgcatactgttgggcaagcttgagcgaaacacatctatgtgtttgccacttg
gattcctatggtgattctgatgatgtatgccaaggaaacaattgttcctcctcatgtcca
gccggatatgaatacatatgcaaacccataagtccaagtatcatgacaaaagaccctaaa
agatctcaaattttgcccattatcgtaggttgcggagctagtattgggacaatatttgtg
ctacttggtgcatggcaatcgcacaaacttctgcaaagaagaaacaataccaagctgaag
cagaaatactttaaaagaaacggaggcttactactgcaacaacaattgtccaacaatgaa
ggtaaggttgagaaaattaaagtttttacttcaaaggagttggaaaaggcgacggattat
tataacgagaatcgaattcttggtcaaggcggtcaagggactgtttataaaggaattttg
acagatggcaacattgtggctattaaaaagtctaaattggttgaagagaaggtattagat
gataagaagcttaaacagttcattaatgaggtgataattttatcacaaattaaccataga
aatgtggttaagcttttaggatgttgcctagagaccaaaatccctttgttggtgtatcag
ttcatcccgaatgggacactatatgacctcctacataggccaaatgaagagttcccattg
acttgggaaatacgtttacgaattgcaattgaaattgcaaatgctttatcctacttgcat
tcagctgcttctgtccctatttatcatcgagacatcaaatctagcaacatactattggat
gataaatacaaagcaaaagtgtcagatttcggaacttcaatatcaattgcgcttgagcaa
actcatgtaaccactcgagtacaaggaacttttggatatttggatccagaatattttcga
tcaaaccaattcacagaaaagagtgatgtgtatagttttggagttgttcttgttgaactt
ataacaggacaaaaacccatctcctcaagcgaatcagaggaagtggtgagaagcttggca
aacttttttctactctcaatggaggagaatgccttactcaacgttgttgatccattggta
atgaatgctaatgcaaaagaagaaattgtagcggtggctaagctagcaaaaagatgcttg
tatctcaatggaaagaaaagacctacaatgaaacaagttgcaatggaactacaagcaaag
ggacagctctcgagtatctcgcggaatggacaatttcgagtataa

DBGET integrated database retrieval system