KEGG   Gossypium arboreum: 108462608Help
Entry
108462608         CDS       T05776                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gab01001]
    108462608
Enzymes [BR:gab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108462608
Protein kinases [BR:gab01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108462608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like PrgI Pkinase_fungal YukC
Motif
Other DBs
NCBI-GeneID: 108462608
NCBI-ProteinID: XP_017618026
Position
13
AA seq 351 aa AA seqDB search
MNWRACIAFLLITVLLILIALLILGVIYNNTPLFVAALIVLPLFVAYLFIRLKNGFKDVP
KENGFLEVEEVYLENMLGMPTRFSYQELKNVTNNFSNKLGEGGFGSVFHGTLPSGSQVAV
KHLVGFGPVNKSFIAEVQTIGSIHHFNLVSLVGFCAEKFNYLLVYEYLVNGSLDRWIFNQ
NQKLALGWQIRKKIILDIAKGLAYLHEDCHQKIIHFDIKPENILLDEKFNAKVSDFGLSK
LIGRDQSQVLTTMRGTPGYMAPEWLTSTITEKVDVYSFGIVVLEILCGRRNIDRSQQEED
WHLLELFRRKQEEGQLLDLVDKCNSDMQSNAIEVVEMMKVVACFLRAQLML
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaattggagagcctgtatcgcctttctacttatcacagttttgttgatactgatagct
ctactgatactaggagttatatataataatacgccactatttgtagccgctttgattgtt
ctacctctttttgtggcttacctttttataagacttaaaaatgggttcaaagatgtacca
aaagaaaatgggttcctagaagttgaggaagtgtatctggaaaacatgttggggatgcca
acaagattctcttatcaagagttgaaaaacgttaccaataattttagcaacaaacttggt
gaaggtggatttgggtctgtttttcatggaacactaccttcgggttctcaagttgcagtg
aaacatcttgttggctttggtccagtcaacaagtccttcatagctgaagttcagacgatt
ggaagcatccaccatttcaatttggtaagtctggttggattttgtgctgaaaaattcaat
tatcttttagtttacgagtacttggttaatggatcactagaccgatggatcttcaaccaa
aaccaaaaacttgctcttggttggcaaattagaaagaaaatcattctagatatagccaaa
ggactagcctatcttcatgaagattgccaccaaaagataattcatttcgacatcaaacca
gaaaatatccttttagacgagaaattcaatgccaaagtttcagattttgggttatctaag
ctaattggaagagatcaaagtcaagtcctaacaactatgaggggaacccctggttatatg
gctcccgaatggctaacttcaaccataactgagaaagtagatgtctatagctttggtatt
gtggtcctagaaattctgtgcgggcgtcgaaacatcgatagatctcaacaagaagaagat
tggcatttattggaactgtttaggagaaagcaagaagaagggcaactcctggatttagtt
gataagtgcaatagtgatatgcaatcgaatgcaattgaagttgtggagatgatgaaggtc
gttgcatgctttttgagggctcagctgatgttgtaa

DBGET integrated database retrieval system