KEGG   Gossypium arboreum: 108463634Help
Entry
108463634         CDS       T05776                                 

Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
gab  Gossypium arboreum
Pathway
gab00350  Tyrosine metabolism
gab00360  Phenylalanine metabolism
gab00380  Tryptophan metabolism
gab00950  Isoquinoline alkaloid biosynthesis
gab00965  Betalain biosynthesis
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108463634
   00360 Phenylalanine metabolism
    108463634
   00380 Tryptophan metabolism
    108463634
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    108463634
   00950 Isoquinoline alkaloid biosynthesis
    108463634
   00965 Betalain biosynthesis
    108463634
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    108463634
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gab04147]
    108463634
Enzymes [BR:gab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     108463634
    4.1.1.105  L-tryptophan decarboxylase
     108463634
Exosome [BR:gab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108463634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 108463634
NCBI-ProteinID: XP_017619034
Position
13
AA seq 486 aa AA seqDB search
MGSASRKTFLPLDPMTFSNESKAVIDFISDYYENLEKYPVQCTVEPGYLSAMLPESAPYC
PETLQDILEDVNNCIIPGLTHWQSPNFFAYFHANASTAGFLGEMLCLGFNVVGFNWISSP
AATELESIVLDWMGKMLKLPSSFLFSGTGGGALHGSTCEAVVCVMAAARDKALKELGGWE
NITKLVVYASDQTHFTFQKAAKLVGIPPSNSGLIETSFSTGFSLSPENLRFVIEDDIKSG
LVPLFLCATIGTTPSGAVDPIAELGKVAMEFKLWLHIDAAYAGSGCICPELRHYLDGVEL
ANSISMNPHKWFLTNMDCCCLWIKEPKLLVDSLSTDPEILRNNASKSKAVVDYKDWQIAL
SRRFRALKLWVVIRRHGLANLMYHIRSDIAMAKRFEALVGEDERFEIVVARKFALVCFRL
KPKVEAEDLNCKLVEAINSSGRAFVSHAVLSGIYVIRCAIGTTLTQQHHVDALWKLIQDK
AQSLLM
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgcgtcaagaaaaacattccttccccttgatccaatgaccttctcaaacgag
tccaaagcagtgattgatttcatttctgattactatgaaaaccttgagaaatacccagtt
caatgcaccgttgagcccggttatttgtcggccatgttgcctgagtcagccccttattgc
cctgaaacactccaagacatactcgaagatgtcaataattgcatcatcccaggcctgact
cattggcaaagtcccaacttcttcgcctatttccatgcaaatgctagcactgctggcttt
cttggggaaatgctttgtttgggttttaatgtcgttggtttcaactggatttcgtcaccg
gcggcgactgagctcgaatccattgtcttggattggatgggcaaaatgcttaagctacca
tcttccttcttgttctctggaaccggtggtggagccttgcatggcagtacatgtgaggct
gttgtttgcgttatggctgctgcaagggacaaagccttgaaagagcttggagggtgggaa
aacataaccaaactggtggtttatgcttcggatcaaacgcatttcactttccaaaaggca
gcgaaactcgtaggcattcccccatcaaattctgggttaattgaaacatctttttcgaca
gggttttcgttgtcacctgaaaaccttcgcttcgtcattgaagacgatatcaaatctggt
ttggtgccattatttttatgtgcaaccattgggacaacaccctctggagctgtcgatcct
attgcagagttgggcaaagttgccatggaattcaagctttggcttcacattgatgcagca
tatgcaggaagtggctgcatttgccccgagctccgccattatcttgatggagtggagctt
gctaactccatcagcatgaatccacataaatggtttctcacaaacatggattgctgttgt
ctttggatcaaggaaccgaagttgttggtggattcattgtcaactgaccctgaaattcta
agaaacaacgcaagtaaatccaaagcagtggtggactacaaagattggcaaatagcattg
agtagacgttttagggctttgaagctttgggttgtgattcgccgacatggtctggctaac
ttgatgtaccacattcgaagcgatatcgccatggctaaacgattcgaagcacttgtggga
gaagatgagaggtttgagatcgtagtggccagaaagttcgcattggtttgcttcaggttg
aagcccaaggtggaggcggaggatctgaactgtaaattggtggaggccataaattcaagt
ggcagagcgttcgtgagccatgcagtgttgagtgggatttatgtaattcgatgtgccatt
ggaacaactctaactcaacaacaccacgtggatgccttgtggaaactcatccaagacaaa
gctcaaagtttattgatgtag

DBGET integrated database retrieval system