KEGG   Gossypium arboreum: 108463838
Entry
108463838         CDS       T05776                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
gab  Gossypium arboreum
Pathway
gab00100  Steroid biosynthesis
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
Module
gab_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    108463838
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     108463838
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 108463838
NCBI-ProteinID: XP_017619275
UniProt: A0A6P4NCH5
Position
2
AA seq 373 aa
MSREMDLGFLLQALIPSWISVAVLLIFFAYLAIAGSILPGKLVPGVTLQDGSHLYYRCNG
LRALLLLVGLLGIGSKMNFVSPTVISDRGLELLSTTFIFSFLTMVVLYAAGCRSRSKGSS
LKPHITGNLIHDWWYGIQLNPQFMGIDLKFFFVRAGMMGWLIINLSVLAKSVQDGSLSQS
MILYQLFCAFYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLNNK
VELTTAAAIANCFVFLIGYLVFRGANKQKHIFKQNPKALIWGKPPKVIGGKLLASGYWGI
ARHSNYLGDLLLALSFSLPCGLSSPIPYFYPIYLFILLVWRERRDEARCAEKYKDIWAEY
CRLVPWRIFPYLY
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgagcagagaaatggatctgggttttcttctacaggctttaattccctcttggatctct
gttgctgtattgttgatattctttgcttacttagctattgctggatctatattacctgga
aaacttgttcctggagtcacattacaagacgggtctcatctctattaccgctgcaatgga
ttgcgagctcttcttttgttagttgggctccttgggattgggtctaagatgaattttgta
tcaccaacggtaatatccgacagaggacttgagctgttatcgacaactttcatattcagt
tttcttacaatggtagtactctatgctgctggctgcaggtcacgcagtaaaggttcttca
ttaaagcctcacatcacagggaacctgatacatgactggtggtatgggatacagcttaat
cctcagtttatgggtattgatctcaagttcttctttgttagagctggaatgatgggatgg
ctaattatcaatctatcagttcttgcaaaaagtgttcaagatggctctttaagccaatca
atgatcctttaccagttattctgtgcgttctacatcctggactattttgtgcatgaggag
tacatgacctccacttgggacataattgccgagaggttaggcttcatgttggtgtttgga
gatctagtgtggattcccttcacatttagcatccagggttggtggcttttgaataacaaa
gtggagctgacaacagccgctgcaatagcaaattgttttgtttttctgatcgggtatctt
gtatttagaggagccaataagcaaaagcatatattcaaacagaacccaaaagcgcttata
tggggtaaacctccaaaggttatcggcggaaagctgcttgcttctggttattggggaatt
gcaagacactcaaattacctaggggatttgttgctggctttatctttcagtttaccttgc
ggattaagttccccgattccgtacttctacccgatttatctgtttattctattggtatgg
agagaaagacgagatgaagcacgatgtgcagagaagtacaaagatatatgggcagaatat
tgcaggcttgtaccgtggagaatatttccatatctgtattag

DBGET integrated database retrieval system