KEGG   Gossypium arboreum: 108464292Help
Entry
108464292         CDS       T05776                                 

Definition
(RefSeq) putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C isoform X1
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
gab  Gossypium arboreum
Pathway
gab00562  Inositol phosphate metabolism
gab01100  Metabolic pathways
gab04070  Phosphatidylinositol signaling system
gab04145  Phagosome
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108464292
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108464292
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108464292
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gab04131]
    108464292
Enzymes [BR:gab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     108464292
Membrane trafficking [BR:gab04131]
 Endocytosis
  Macropinocytosis
   Kinases
    108464292
 Endosome - Golgi transport
  Others
   Others
    108464292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K Cpn60_TCP1 Glycos_transf_1 Laminin_II
Motif
Other DBs
NCBI-GeneID: 108464292
NCBI-ProteinID: XP_017619998
Position
13
AA seq 1658 aa AA seqDB search
MMIGVDKDLFQGLINCLDLILRMISTKFCKFCCDGVNVRRESRGMKYCDKVHPSLCESSE
PPSPCFVNLETIKSDSLAQYLEAYDCEFTMQPVTSKIITSFSTHPSPVSISQSACRCRSD
EEDANDFGKHFLSPSTKYCQDVSNVDSHSLNGRHDFYSCKSVGSSPSVNPFRNNFTPYRV
GISVQKKQEGSPMAQYVAPFYQENMDALRKPNIGTEELDNIYDYSDDFIFHNHYEKSQKL
LDFENNGLIWFPPPPEDENEEIESNFFTYDDEDDDIGDSGAMFSSSSSLSSMFPVREKQN
EGIKEPLKAIIQGHFRVLVLQLLLSEGIKVGKEDNAGDWLDIITTIAWQAAKFVKPDTSR
GGSMDPGDYVKVKCIASGNPSESTLVKGVVCTKNIKHKRMTSQYKNPRLLLLGGALEFQK
APNQLASFSTLLQQENDHLKMIIAKIEALHPNVLLVEKSVSSYAQEYLLEKEISLVLNVK
RPLLERIARCSGALVCPSIDNLSIARLGHCKLFRVKKVSEEHEISNQLNKKPSKTLMFFE
GCPRRLGCTVLLRGRSREELKKVKHVVQYAVFAAYHLSLETSFLADEGATLPKMKVKHSV
IRPEKMQSDNVILVAPSSFYPSNFNAIGNSFTQNDASPSLNPKQGSLESFPNQDDQIHIS
PSFGGSILDTCNDDLTPIVDMDLCSLEQLSRLQMPTMFPCDIRDFPQSEKRETVTEEERH
NMHELEKSKKIIEDEASSGCFSATDTHQSILVSFSSRCVLKGTVCERSRLFRIKFYGSFD
KPLGRYLQDDLFDQASCCQSCNEPTEAHVICYTHRQGNLTINVRRLSSLKLPGERDGKIW
MWHRCLRCAHIDGVPPATHRVVMSDAAWGLSFGKFLELSFSNHATANRVATCGHSLQRDC
LRFYGFGNMIAFFRYTPIDILSVHLPLSMLEFSGDIQREWIRKEAAELMVKVEILYAEVL
DVLDNIEQKNNSSNASDLSNHIMELRDQIQKERNDYISLLQPTAIETSHLDLTTMDILEL
NCLKRSLLIGLHVWDRRLNSLDSHLGKGSAFKGKPGLSKDGKLDAYRQKTYKSTDSLEPP
KSDARLEQNSSLPTFESDVPEELDLALCIENKVENEETDKSVHSPTSTLSERIDSAWIGT
DLLTLKVQYPEAYQGNELQTRLVKPTSKIDNLPLRKVASPMRVHSFDSVLRLQARIQKGL
HPSTLHLSTLKSFHATRDYRTMVRDPVSNVTSTYSYTLPFEAQKLNLSLRSTPTLINCAS
HVAEGARLLLVQRVHSDIVIAVYDNDPASIISYALSSKEYEEWVDDKSIKMGGGWSIIDR
SKKDSATSSFSPWQPFGSLDTDYTHFGSFGSEDTSSSIGAMFTDTKRSPHLIVSFGDDSY
VGGGIVKFSVTCYFAKQFYSLRRKCCPNEVDFVRSLSRCQKWSAQGGKSNVYFAKSLDER
FIIKQVQKTELESFNEFAPEYFKYLSDSLSSGSPTCLAKILGIYQVSVKHLKGGKETKMD
LVVMENLFFRRSISRIYDLKGSARSRYNPDTSGRNKVLLDMNLLETLRTEPIFLGSKAKR
ILERAIWNDTSFLASIAVMDYSLLVGLDEEHNELVLGIIDFMRQYTWDKHLETWVKASGI
LGGPKNASPTIISPKQYKKRFRKAMTAYFLTVPDQWTL
NT seq 4977 nt NT seq  +upstreamnt  +downstreamnt
atgatgataggggttgataaagacctctttcaggggttgattaactgtttggatctaatt
ttgaggatgatcagtactaaattttgcaagttttgttgtgatggggttaacgtgaggcgt
gaaagtagaggaatgaagtattgtgataaagtgcatccctctctctgtgagagctcagaa
ccaccgtccccatgttttgtgaatctcgaaaccatcaaaagtgatagccttgcccaatat
cttgaagcttatgattgtgagtttacaatgcaaccggtaacaagcaagattataacttct
tttagtactcatccttctccggtatctatttcacaatctgcctgcaggtgtaggagtgat
gaagaagatgctaatgattttggtaagcattttttgagcccttcaactaaatattgtcaa
gatgtttcaaatgtagattcacatagtcttaatggtagacatgacttttatagttgtaag
tctgtgggatcaagtccttcagttaatccctttagaaacaattttactccttatagagtt
gggatttctgtacagaagaagcaagaagggagcccgatggctcaatatgttgctcccttt
tatcaagaaaacatggatgctttaagaaagccaaatatagggaccgaggaacttgataat
atttatgattactctgatgattttattttccataatcattatgaaaagtcacaaaagctt
ttggattttgaaaacaatggcctaatatggtttccaccaccacctgaggatgagaatgag
gagatagagagtaacttcttcacatatgatgatgaagatgatgatattggggattctggc
gcaatgttctcatcaagtagtagcctttcaagtatgttcccagtaagggagaaacaaaac
gaaggaatcaaagagccccttaaagctataatacaagggcattttagggttttggtgttg
cagcttttactaagtgagggtatcaaagttggtaaagaggataatgctggggattggctt
gacattatcacaacaattgcatggcaagctgcaaaatttgtgaaaccagatactagcaga
ggaggcagtatggatcctggggattatgtaaaggttaagtgtatagcgtcaggaaatccc
agtgaaagcacccttgtcaagggagtggtatgtaccaaaaatataaaacacaagcgcatg
acctcacaatacaaaaatcctagattacttcttttaggaggagcccttgaatttcagaaa
gctccaaatcagctggcatcgtttagcacattacttcaacaggaaaatgatcatctcaag
atgatcattgcaaagattgaggctcttcaccctaatgttttgcttgtagaaaagagtgtg
tcttcatatgcccaagagtatctgcttgaaaaggaaatatcattagttctcaatgtgaaa
aggccattattagagcggatagcaaggtgtagtggtgctcttgtttgtccatcgattgat
aatttatctattgcacgcttgggccactgcaaattatttcgagtcaaaaaagtatcagaa
gaacatgagatttccaatcaattgaacaaaaaaccatcaaaaacattgatgttctttgaa
ggttgtcccagacgcttaggttgcacggtcttgttgagaggtagatctcgtgaagaacta
aaaaaggttaaacatgttgtccaatacgctgtttttgcagcttatcacttatcgcttgaa
acttccttccttgctgacgaaggtgctactctgcctaagatgaaagtaaaacattcagtt
attagaccagagaaaatgcagtctgacaatgtcattttagttgcccctagttccttttat
ccttccaatttcaatgcaataggcaattccttcactcaaaatgatgcatctccaagtctt
aatccaaagcaaggaagcttagaatcatttcctaatcaggatgatcaaattcatatttcc
ccatcttttggtggttctattctagatacatgcaatgatgatttaacacctattgtggat
atggatttgtgttctttggaacaattgagtcgtttacaaatgcctactatgtttccctgt
gatattagagattttccccaatctgaaaagcgagaaactgtgactgaagaggagaggcat
aatatgcatgaattggaaaaatctaaaaagattatagaagatgaagcttccagtggatgt
ttttcagccactgacacacaccagagtatattggtttcattttcaagtcggtgtgttcta
aaaggaactgtatgtgaacgttcacgactttttcgaataaagttctatgggtcttttgat
aaaccactgggaagataccttcaagatgacttgtttgatcaagcatcttgttgccagtca
tgcaatgagccaactgaagctcatgtcatatgttatactcaccggcaaggaaacctgaca
atcaatgtaaggcgcctttcctctcttaagctacctggtgaacgagatgggaaaatatgg
atgtggcacagatgccttaggtgtgctcatattgatggggttcctccagcaactcataga
gtggttatgtctgatgctgcttggggactttcttttggaaagtttttggagcttagtttt
tcaaatcatgcaactgctaatcgtgttgcaacttgtggtcattccttgcagagggactgc
cttcgtttctatggatttggcaacatgatagcattttttcgctataccccaattgatata
ctatcagtacatttgcccctatcaatgcttgagtttagtggggatattcaacgagagtgg
ataagaaaagaggcagctgagctaatggtcaaagtggaaattttatatgcggaggtattg
gatgtacttgacaacattgaacaaaagaataattcatcaaatgcaagtgacttatcaaat
catattatggaactaagagatcagattcaaaaggagagaaatgattacattagtttgtta
caaccaactgctatcgagacatcacatcttgatttgacaactatggacatcctagaactg
aattgcttaaagcgttcacttctaattggtttgcatgtatgggatcgacgacttaattca
ttggattctcatcttgggaaaggttctgcattcaaaggtaaacctggtctctccaaggat
gggaaacttgatgcttatcgacaaaaaacctacaaatctacagattcactagaacctcct
aaaagtgacgcacgattggagcaaaactctagtttgccaacctttgaatctgatgtgcca
gaagaattggaccttgcattgtgtattgaaaataaagtggagaatgaggaaacagataaa
agtgtccattctcctacatctacattatctgaaagaatagattctgcttggataggtact
gatctacttacattaaaagttcaatatccagaagcatatcagggaaatgagctccaaact
cgcttggtcaagccaacaagtaaaatcgataatcttcctttgagaaaggtagcttctcca
atgagggttcattcttttgattctgtattgagactccaagcaagaattcaaaaaggattg
cacccctcaacattgcatttatcaacacttaaatcatttcatgctactagagattatagg
actatggtgagagatcctgtttctaatgtgacaagtacctactcttatacattgccattt
gaggcacaaaagttgaatttatcacttcgatccacacccacgttaatcaattgtgcatct
catgtggctgaaggggctcggctacttcttgtgcagagggttcacagtgatatcgttatt
gctgtttatgacaatgatcccgcaagtataatatcatatgctcttagttcaaaagaatat
gaagaatgggttgatgataagtccattaaaatgggaggaggttggagtattattgataga
agcaaaaaagattctgcaacttccagcttttcaccctggcagccatttggttcacttgac
acggattatacacattttggaagttttggctctgaagatacttcatcatccattggtgcc
atgtttactgatacaaaaaggtctccacatttaatagtttcttttggagatgactcttat
gttggtggtggcatagtgaagttttctgttacttgttattttgcaaaacaattttattct
cttagaagaaaatgttgccctaatgaagtggattttgtacgttccttaagccgctgtcag
aaatggagtgcacaagggggaaagagcaatgtgtattttgccaaatcgttagatgagaga
ttcattataaagcaagtacaaaaaacagagctagaatcttttaatgaatttgcaccagag
tacttcaagtatttgtctgattctcttagctcaggaagcccaacttgccttgcaaaaatt
cttggtatttatcaggtctctgtaaaacacttgaaaggtgggaaagaaacaaaaatggat
cttgtggtaatggagaacttatttttcagaagaagtatatctaggatttatgatcttaag
ggctctgcaagatcacgatataatccagacacatcaggaagaaacaaagtactattagac
atgaatctgttagaaacattgcgaacagagcctatttttcttggaagcaaggcaaagaga
attctcgagagagctatttggaatgacacatctttcttggcatctatcgcagtcatggac
tactcgttattggttggattggatgaggagcacaatgagcttgtattaggaatcattgat
ttcatgagacaatatacctgggacaagcacttggagacatgggttaaagcatctgggata
ctaggtgggccaaaaaatgcgtccccaacaattatttctcccaaacaatacaagaaaaga
ttccgaaaagcaatgactgcatattttctcacagtacctgatcaatggactttgtga

DBGET integrated database retrieval system