KEGG   Gossypium arboreum: 108469951Help
Entry
108469951         CDS       T05776                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
gab  Gossypium arboreum
Pathway
gab00480  Glutathione metabolism
gab00590  Arachidonic acid metabolism
gab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108469951
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108469951
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     108469951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-GeneID: 108469951
NCBI-ProteinID: XP_017626573
UniProt: A0A0B0NC79
Position
3
AA seq 166 aa AA seqDB search
MASQSSKGSVHDFTVKDARGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELSKLYEQYK
DQGFEILAFPCNQFGGQEPGNNEQILEFACTRFKAEYPIFDKVDVNGEKAAPVYKFLKSS
KGGLFGDSIKWNFSKFLVDKEGHVFDRYAPTTSPLSIEKDIKKLLA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcaatcttctaagggatcagttcatgatttcactgttaaggatgcaagaggg
aatgatgttgatttaagtatttacaagggcaaggttttgttgattgtcaatgttgcatca
caatgtggcttgaccaattccaactacactgagctaagtaaattgtatgagcaatataaa
gatcaaggttttgagattcttgcattcccatgtaaccagtttggaggacaggagccaggg
aacaatgagcaaatcttagagtttgcttgcactcgctttaaagctgaataccccatattt
gataaggttgatgtgaatggtgagaaggctgctcccgtatacaaattcctcaagtctagt
aaaggtggactttttggggacagcatcaagtggaatttttccaagttcttggtcgataag
gagggccatgtcttcgatcgttatgctcccactacttctcctcttagcattgagaaggat
attaagaaactgctggcttga

DBGET integrated database retrieval system