KEGG   Gossypium arboreum: 108470762Help
Entry
108470762         CDS       T05776                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
gab  Gossypium arboreum
Pathway
gab00510  N-Glycan biosynthesis
gab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    108470762
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gab01003]
    108470762
Enzymes [BR:gab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     108470762
Glycosyltransferases [BR:gab01003]
 Glycan extension
  N-Glycan
   108470762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 108470762
NCBI-ProteinID: XP_017627700
Position
1
AA seq 421 aa AA seqDB search
MANYKKPRFKDAAFKRYLSVVLGTLLLVSLLVVSLGTNATPGSSGLDEGLSESVVNIQSF
REKLNLPKENDFSIRLEKQNRLPPRNIDLYPRLAKDHITIVLYVHNRPQYLRVVVNSLSK
VVGISETLLIVSHDGYFEEMNKIVEGIKFCRLKQIFAPYSPHVFTDSFPGVSSKDCQEKD
DAGKKHCVGNPDQYGNHRSPNIVSLKHHWWWMMNTVWDGLKETRGHDGHILFIEEDHFIY
PNAYRNLQLLVSLKPNKCPDCYAANLAPCDVNLRGEGWNSLVAERMGNVGYAFNRTVWRK
IHGKAKEFCFFDDYNWDITMWATVYPSFGSPVYTLRGPRTSAVHFGKCGLHQGQGKTNAC
IDNESVNVQVDDTDKVANIRPEWDVKVYQNQPGYKAGFKGWGGWGDNRDHRLCLNFAQMY
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctaattacaagaaaccccgtttcaaagatgcagcttttaaacgttacctctctgta
gttttaggtactctactactggtttcacttttggtagtttctcttgggaccaatgcaacg
ccaggttcaagtggattagatgaaggtttaagtgaaagtgttgttaatattcagagtttt
agggaaaaactcaaccttcctaaagagaacgatttttcaattcgattggagaaacaaaac
cggttgccccctaggaatatagatctatatccaaggttagccaaagatcatataaccatt
gttttatacgtgcataatcgccctcaatatctccgagtagttgttaatagcttgtcgaag
gttgtggggataagtgaaactttattaattgtcagccatgatggatactttgaagaaatg
aacaagattgtggaagggatcaaattttgccgattgaaacagatctttgccccttattcg
ccccatgtatttactgacagttttcctggtgtgtcgtcgaaggactgtcaagaaaaagat
gatgctgggaagaaacattgtgttgggaatccagatcagtatggaaaccaccggtctcca
aatatagtttctttgaagcatcattggtggtggatgatgaacactgtgtgggatggattg
aaggagactagagggcatgatggacatattcttttcatagaggaggaccacttcatttac
cccaatgcgtatcgcaacttacagcttcttgtatcactgaagcctaacaaatgcccagat
tgctatgctgcaaatctggcaccctgtgatgtgaatttaagaggagaaggatggaatagt
ttggttgctgagagaatgggaaatgtgggttatgccttcaaccggactgtatggagaaaa
atccatgggaaggctaaagagttctgcttctttgatgattacaattgggatataacaatg
tgggcaaccgtctatccttcgtttggtagtccagtgtacacgttacgaggtccaaggact
agtgcagttcactttgggaagtgtggtttgcatcagggccaagggaagactaatgcttgc
attgataatgaatcagtgaacgttcaagtagatgacactgataaggttgctaatatcaga
ccagaatgggatgttaaagtatatcagaatcaaccagggtataaagctgggtttaagggt
tggggtggctggggggataatagagatcaccgattgtgcttgaattttgctcaaatgtac
cattaa

DBGET integrated database retrieval system