KEGG   Gossypium arboreum: 108472788Help
Entry
108472788         CDS       T05776                                 

Definition
(RefSeq) non-specific phospholipase C4-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
gab  Gossypium arboreum
Pathway
gab00562  Inositol phosphate metabolism
gab00564  Glycerophospholipid metabolism
gab00565  Ether lipid metabolism
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108472788
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108472788
   00565 Ether lipid metabolism
    108472788
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:gab02042]
    108472788
Enzymes [BR:gab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     108472788
Bacterial toxins [BR:gab02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   108472788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 108472788
NCBI-ProteinID: XP_017629833
Position
4
AA seq 513 aa AA seqDB search
MVSQGSNSASSYPIKTIVILVQENRSFDHMLGWFKSLNPEIDGVTGSESNPISTSDPNSP
MVFFKDNSEYVDPDPAHSIQAIYEQVFGQPWSSDLPNPPHEPTMNGFAQNAERTEKGMAE
AVMKGFKPDAVPVYKELASKFGICDRWFASVPSSTQPNRMFVHSATSYGQTSNDAIKLIK
GFPQKTIFESLDESGFSFGIYYQYPPSTLFFRNLRQMKYLKNFHQFDLHFKKHCEEGKLP
NYVVVEQRYFDLLSVPANDDHPSHDVSEGQKFVKEVYEALRSSPQWREMLLVITYDEHGG
FYDHVPTPTTGVPSPDDIVGPEPYHFRFDRLGVRVPTFFVSPWIEPGTVIHRPSGPYPTS
EFEHSSIPATVKKIFNLKEFLTKRDAWAATFEGVINRKNPRVDCPVTFPEPVNMRPTEAK
ETVKLSDFQKELVQMAAVLNGDHKSGMYPHKLVEKMTVAEAAKYVNGAFDKFCDECQRGG
IHESEMVELGKQVERPKGRSFIDKFFKCLVCHD
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggtttcccaaggcagcaatagtgcgtcttcgtatcctatcaaaaccatagtgatattg
gtccaagaaaaccgctcattcgatcacatgctaggctggttcaagtccctaaaccctgaa
atcgatggcgtaaccggatccgaatccaaccccatttccacatccgacccgaactcaccc
atggtcttcttcaaagacaattccgagtacgtagaccctgaccctgctcactccatccaa
gccatttacgagcaagtattcggccagccttggagctctgacctccctaacccacctcat
gaacccacaatgaatgggttcgctcaaaacgctgagaggaccgaaaagggaatggcagag
gcagtgatgaaagggtttaaacctgatgcggtgcctgtttacaaagagctggcgtccaag
ttcggaatatgtgaccggtggttcgcgtcggtgccatcttcaacgcaaccgaaccggatg
tttgtgcattcagctacatcgtatggacagacgagcaatgacgcaataaagctgatcaaa
gggtttcctcaaaagacaatattcgagtcattggatgaaagtggttttagttttgggata
tattatcaataccctccctccaccttgttcttcaggaaccttagacaaatgaagtactta
aaaaactttcatcaatttgatctgcacttcaagaaacattgtgaagaagggaagcttcca
aattacgtggtcgtcgaacaacgatactttgacctcttgtcggtgcctgcgaacgacgat
catccgtcccatgatgtctcagaaggacaaaaatttgttaaggaagtatacgaggcacta
cgaagtagcccccagtggagagaaatgttgttggtaatcacatatgatgaacatggtgga
ttttatgaccatgttccaacacctacaactggggtccctagccctgatgatattgttggt
cctgagccttatcatttcaggtttgataggcttggtgttagggttcctacattttttgtt
tctccatggattgaacctggaacagtgatacataggccttcaggcccatatcctacttca
gaatttgagcattcatcaattcctgcaactgtcaaaaagattttcaacctgaaagagttc
ctaacaaagcgtgatgcttgggctgctacttttgaaggtgttataaacaggaagaaccca
agagtagattgtcctgttacatttcccgaaccggtgaacatgagacctactgaagcaaaa
gagacggtaaaattaagtgatttccaaaaagaattagtacaaatggcagcagtgttgaat
ggagaccataaaagtggcatgtatccacacaaacttgtggagaagatgacagttgcagag
gctgccaagtatgtgaatggtgctttcgataagttctgtgatgaatgccaaaggggaggg
atccatgaatctgagatggttgaattaggaaaacaagttgaaaggccaaaaggcagatct
tttattgacaagttttttaaatgtcttgtctgccatgattga

DBGET integrated database retrieval system