KEGG   Gossypium arboreum: 108473130Help
Entry
108473130         CDS       T05776                                 

Definition
(RefSeq) receptor-like protein kinase FERONIA
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gab01001]
    108473130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 108473130
NCBI-ProteinID: XP_017630175
Position
1
AA seq 414 aa AA seqDB search
MRTPPLSSFCFCPVSESKLKKKPSKGKAKSSLPQHLCRRFSLDEVRVATNNFDSQLILGK
GGSAVVYKGFFDDGASVFAVKYFLLGSSRQKILEDFRNEVQLLCQLRHQHIVSLIGFCDE
EDKMIIMYNYMSQGSLFDHLHGTGHHDPLPWKQRLEICIGIARGLHYLHAGAKRAVIHRD
IKTRNILLDYQKVSKISDFTLSKIGPFSLSNAPIRIELPPLDEIELQTSRTRLFGTLGYV
APELFMDTTLVTEKSDVYSFGVVLLEVLCGRKVLKFDAGDHNHCHIISWVNEHLKNGRIY
QMTDPYLEGKIAPSCLQKFLDIALSCVHVGEHKRPALGEVEVTLELALELQNKADSEVER
HGEVISEEVVLSASAFNFSDYQTDVLWPHGSYRVEDAFSCKYEDMLSDIEELCR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcctccactttccagcttttgtttctgtccagtatctgaaagcaaattaaag
aagaagccgagcaagggaaaagctaaatcatcacttccccaacatctgtgccgtcgattt
tctctcgacgaagtcagagttgccaccaataactttgactcccagttgattcttggtaaa
ggtggcagtgcagttgtatacaaagggtttttcgatgacggggcttcggttttcgctgtc
aaatactttctgctcggatcctcacgacagaaaatacttgaggactttcgaaatgaggtg
cagctactttgccagctgcgccaccaacatattgtttctctgattggattctgcgatgag
gaagacaagatgatcataatgtacaattatatgagccaggggtcactcttcgatcatctc
catggtactggtcatcacgatcccctcccatggaagcaaaggttagagatttgcattggg
atagctcgtggattacattatcttcatgctggagcaaagcgagcagttatccaccgcgac
atcaagaccagaaacattcttttagattaccaaaaggtttccaagatttcggatttcacc
ttgtctaagataggcccttttagtttatcaaacgctcccatcagaatagagttaccccct
ctggatgaaattgaattgcaaacaagtcgaacgaggctgtttggtactttgggttatgtg
gctcctgagcttttcatggatactactcttgtgacagagaaatcagacgtttactcattt
ggggttgttttgcttgaagtactttgcggtagaaaagtattaaagtttgatgcaggggac
cataatcattgtcatataatttcatgggttaatgaacacctaaagaatggaagaatttac
caaatgacggatccatatttggaagggaaaatagccccaagttgcttacagaaattcctg
gacatcgcattaagttgcgtccatgttggggaacataaacgacctgctcttggtgaagtg
gaggtgacactagagcttgctttggagctccaaaacaaagcagactccgaagtggagagg
catggtgaagttatttctgaagaagtagttttgtctgcatctgccttcaatttctctgac
tatcagactgatgtactctggccccatggaagttatcgtgtggaggatgcatttagctgc
aaatatgaggatatgttgtcagacattgaagagctgtgcagatga

DBGET integrated database retrieval system