KEGG   Gossypium arboreum: 108475540Help
Entry
108475540         CDS       T05776                                 

Definition
(RefSeq) glutathione transferase GST 23-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gab  Gossypium arboreum
Pathway
gab00480  Glutathione metabolism
gab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108475540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gab02000]
    108475540
Enzymes [BR:gab01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108475540
Transporters [BR:gab02000]
 Other transporters
  Pores ion channels [TC:1]
   108475540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 108475540
NCBI-ProteinID: XP_017633005
Position
5
AA seq 223 aa AA seqDB search
MAVLKLFGAWPSPYVFRVIWALKLKGIPYEYIEEDLSNKSPLLLQYNPIHKKVPVLVHDG
KPICESTVILRYIDEIWPQNPLLPTDPHERAVALFWIKFADDKSPFISKLYRTDGEEQQV
AAKECFEMLEAVEGHALVGGKKFFGGDEINMVDIAFCSVAHWLGVIEGFTGLKIFEPHKF
PRLNSWIQNFKSVPVIKDNLPDTDKMSAVLKRRREMLLASKSS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcttgaaactgttcggagcttggcctagtccgtacgttttcagagtaatttgg
gctttgaaactcaaaggcataccttacgaatacatcgaagaagatctctccaacaagagt
cctttgcttcttcaatataatccaattcataagaaagtcccggtgctcgttcatgacgga
aaaccgatctgcgaatccaccgtcatccttcgatatatcgatgaaatttggccgcaaaat
cccttgctgccgactgatccccatgagagagccgttgctctgttttggatcaaatttgct
gatgacaagagtcctttcatctcaaagctttatcgaacggacggcgaagaacagcaggtg
gcagcgaaggagtgcttcgaaatgctagaagcagttgaagggcacgcgttggtcggaggg
aaaaaattcttcggcggagacgagataaacatggtggacattgcattttgctccgttgct
cactggctcggggtcatcgaaggctttacagggcttaaaatctttgaaccacacaagttc
cctcgattgaattcgtggatccaaaatttcaaatcagtccctgtaatcaaagacaactta
cccgatactgataagatgtctgcggtgttgaaacgtcggagagaaatgttgctggcatca
aaatcgagttag

DBGET integrated database retrieval system