KEGG   Gossypium arboreum: 108475946Help
Entry
108475946         CDS       T05776                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP28, chloroplastic-like
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gab03110]
    108475946
Enzymes [BR:gab01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     108475946
Chaperones and folding catalysts [BR:gab03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    108475946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 108475946
NCBI-ProteinID: XP_017633445
UniProt: A0A0B0N4V9
Position
5
AA seq 289 aa AA seqDB search
MASPLSPIHHLPFLSSSSTATTLTRRSLLLSSTLTTTLPTTPLSLPPQLDTNITDRVYLD
FSLCPTYFRNATAADSTPLCSDPSPLGRLVLGLYGNLLPLTVFTFKRMCTSSSYKNTLVH
KIFPGQFFQAGRQGRSREYGEVRLPPALDLPRNTETVDSKAFLLKHSRPGVVSLCLSEND
DDDEVKLDSEYRNVEFLITTGPGPCPQLDNNNIVFGTVLEGLDVVTAIASIPTYKPSERI
RQLNDLAEFFGDERAQKGRTLWNRPLKTVYISDCGELQVTKPSMSPTLP
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccctctatcaccaatccatcatctaccctttctctcttcttcgtccaccgct
accaccctcactcgccgctctcttctcctctcctccaccctcaccactaccctccccacc
acccctctctcattaccacctcaactagacaccaacataaccgaccgggtctaccttgac
ttctccctctgcccgacctacttccgcaatgctactgccgccgacagcacccctctatgc
tccgacccttctccgttaggccgcctagtcctcggcctctacggaaacctccttcctcta
actgtcttcactttcaagcgcatgtgcacctcttcctcctacaaaaacaccctcgtccac
aaaatattccctgggcagttcttccaagctggacgccaaggccgcagtagagaatacggc
gaagtccgtttgccccctgccttggacttgcctcggaacactgagactgtcgactctaag
gccttcttgcttaaacattcaaggcccggtgtcgtttccctttgtttgtcagagaacgac
gacgatgatgaagtcaagcttgattctgagtataggaatgttgagttcttgattactaca
gggcctggcccctgtcctcaactcgataacaacaacattgtttttgggaccgtgcttgaa
gggttggacgttgtgacagcgatcgcttccatcccaacgtacaaaccatcagaaagaatt
cggcaactaaatgacttggctgaattcttcggagatgaaagagcacaaaaagggcgcacg
ttatggaacaggcctcttaaaactgtttatatcagtgactgtggcgagcttcaagttacc
aagccttcaatgtcacctactctgccttaa

DBGET integrated database retrieval system