KEGG   Gossypium arboreum: 108479124Help
Entry
108479124         CDS       T05776                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK8
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gab01001]
    108479124
   01009 Protein phosphatases and associated proteins [BR:gab01009]
    108479124
Enzymes [BR:gab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108479124
Protein kinases [BR:gab01001]
 Serine/threonine kinases: Other
  Wnk family
   108479124
Protein phosphatases and associated proteins [BR:gab01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108479124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C APH
Motif
Other DBs
NCBI-GeneID: 108479124
NCBI-ProteinID: XP_017637030
UniProt: A0A0B0PSE7
Position
6
AA seq 607 aa AA seqDB search
MEVADDCDFAEKDPSGRYVRYDEVLGRGAFKTVYKGFDEADGIEVAWNQINVEDVLQKPE
QLERLYSEVHLLKSLKHVNVIKFYDSWVDDKNKTINMITELFTSGSLRQYRKKHKNVEVK
AIKSWARQILRGLHYLHSHNPPIIHRDLKCDNIFVNGNNGEVKIGDLGLATVLQQPTARS
VIGTPEFMAPELYDEEYNELVDIYSFGLCILEMVTCEYPYNECKNPAQIYKKVTSGIKPA
SLGRVNDPQIKQFIEKCLLPASMRLPAAELLKDPFLLAETPKEPASGPPVNLIQTEPHLM
EIDLNCKMLMVKPSTESIKETPRFSALELQSFTQNNEFRLKGEKNDDNTISLTLRIADQC
GRARNIHFSFYLDSDTAISIAEEMVQQLDLSNEDVTVIAELIDSMIVKLVPCWKPSVGSI
SCLQDCLCYPSQATIKTVGEQEVFPRLAVLNCQDTEESFGSDISAESNGMVASDGSNNKP
MGSSDHSYVECHNGLNAYDFGLDIGAYNHEDTSDEKNLAEYIAIKHSAKNSDTSLMDSCS
FASQDMSLSSIGSLSLADKDKLEELKSELDAIDSQYQQCFQELLRMREEAMESARKRWIS
KKKVSVM
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggctgatgactgtgatttcgctgagaaagatccgtcgggtcggtatgtgagg
tatgatgaggtcctagggaggggagcattcaagactgtttacaagggatttgatgaggct
gatggaatagaggttgcatggaaccaaatcaatgttgaagatgtgttgcagaagcctgag
cagctggaaagactatattcagaggttcatcttctgaagtcactgaagcatgtaaacgtt
atcaagttctacgattcctgggtggatgataaaaacaagaccatcaacatgataactgag
ttgttcacttcggggagtttgaggcaataccgtaagaagcataagaatgttgaggtgaag
gctattaagagctgggcacggcaaatccttagaggcttacactatctgcatagtcacaat
cctccaatcattcatagagatttaaaatgcgataatatatttgttaatggaaataatgga
gaagtgaagattggagatcttggattggcaactgtcttgcagcagcccaccgcccgaagt
gtaattggcactcctgaattcatggctccagagctttatgatgaggagtataatgagctt
gtcgacatatattcttttggtctgtgcatattggagatggttacttgtgaatatccatat
aatgaatgcaaaaatccagcacaaatatacaagaaagttacctctggtattaaacccgct
tcccttggtagagtgaatgatccacaaattaagcagtttattgagaagtgtcttcttcca
gcatctatgagattgccagctgcggaactcttgaaagatccattccttttggctgaaact
cccaaggagcctgcgagtggtccaccagtgaacttgatccagactgaacctcatctgatg
gaaatagatctcaactgcaaaatgcttatggtcaaaccttctactgaaagcatcaaagaa
actcctcggttctcagctctggagctacagtctttcactcagaataatgaatttaggttg
aaaggggagaagaatgacgataatacaatttcattgaccttgcgcattgctgatcaatgt
ggtcgagcaaggaatatccacttttcattttatctggattcagatactgctatttcaatt
gctgaggagatggttcaacaacttgatttgtcaaatgaagatgtaactgtcattgcagag
ttgattgatagcatgatcgtgaagcttgttccctgctggaaaccttcagttggaagcatt
tcatgcctacaagattgcttatgctacccaagtcaggccactattaagacggttggtgaa
caagaagttttcccacggttggctgttcttaactgtcaagacaccgaagaatcttttggt
tcagatatatcagctgaatctaatggaatggtggcctcagatgggagtaacaacaaacca
atgggatcttctgatcacagttatgttgagtgccataacggtttgaacgcatatgatttt
ggtttagatattggggcttataaccatgaagataccagtgacgagaaaaaccttgcggaa
tatatagcgataaaacattccgcaaagaactctgacacgtccttaatggattcttgttca
tttgcttcacaagacatgagcttgtcaagcatcggctctctatcccttgcagacaaggac
aagttggaagagctgaaatcggagcttgatgcaatagattcacagtaccagcaatgtttc
caagagctcttaaggatgagagaagaagcaatggaaagcgccaggaagaggtggatatca
aagaagaaagtatctgtgatgtga

DBGET integrated database retrieval system