KEGG   Gossypium arboreum: 108479999Help
Entry
108479999         CDS       T05776                                 

Definition
(RefSeq) beta-glucosidase 12-like
  KO
K22279  vicianin beta-glucosidase [EC:3.2.1.119]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108479999
Enzymes [BR:gab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.119  vicianin beta-glucosidase
     108479999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 108479999
NCBI-ProteinID: XP_017638375
Position
6
AA seq 486 aa AA seqDB search
MGKKGALLLCLLVLMVAMDGAIASHKWRPFNRSCFPPGFIFGAGSAAYQIEGAALEDGKG
PSVWDILVRKHPERIVDRSTGDVAVDFYHRYKEDIMLMKKIGLDSFRFSISWTRILPTGK
LSGGINRLGVQFYNNLIDDLLANGLKPFVTLLHFDHPQALEDEYGGFSSPKIVDDFVDYA
DFCFKTFGDRVKHWVTMNEPNGWSLGLATGLPPSSTQSYILAHHFLLSHAAAANLYRKKY
QASQKGKIGITLVTTWFEPKFDTTADRKAASRARDFHFGWFMDPVIYGEYPKSMQSLVGN
RLPKFTEAESKLLKGSIDFLGANYYTTNYAENGPSNTPFLPTDAGVNLTTEKNGVPIGTP
TDVSWLFNYPKGLRDLLLYLKKKYNSPTIYITENGVAEAKNASLTVKEALKDSTRIRYLD
GHLKCLLKAIQEGVNMKGHYMWAFLDDFEWTSGYTLRFGFTYTDYKNNLRRYLKYSAYWF
KKFLLN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaagggggcgttgttgctgtgcttgctggtgctaatggtagccatggatggt
gcaatagcaagtcataaatggaggccatttaaccgaagctgttttccacctggttttatt
ttcggtgctgggtcggctgcttaccagatcgaaggagcagctcttgaagatggaaaagga
ccaagtgtatgggacattctggttagaaaacatccagaaagaattgttgatagaagtaca
ggagatgttgcagttgatttttatcatcgttacaaggaagatattatgcttatgaaaaaa
attggtttggattccttcagattctccatttcatggactagaattttacccacggggaaa
cttagtggcgggataaaccgattgggtgtccaattttacaacaatctcatagatgatctt
cttgccaatggtttaaagccctttgtcactttactccattttgatcatccccaagctctt
gaagatgaatatggtggattttcaagtcccaaaattgtggatgactttgtagattatgct
gatttttgctttaaaacatttggggatcgagtcaagcactgggtgactatgaatgaaccc
aatgggtggagcttaggccttgccactggcttacctccctcttcaacccagtcttatatc
ttagcccatcattttcttctttcccatgcagctgccgccaatctctatagaaagaaatac
caggcatctcaaaagggaaaaattggaatcaccttagtaaccacttggtttgaaccaaaa
tttgatacaaccgcggaccgcaaggcagcttccagggctcgggatttccattttggatgg
tttatggatccagtaatatatggtgagtatccaaagagcatgcaatcattggtaggaaat
agactgcccaaattcactgaagcagagtccaagctgttaaaagggtcaattgatttcctt
ggtgcaaattactacaccactaactatgcagaaaatggtccatcgaatactcccttccta
cctactgatgccggagtaaatctcacaactgagaagaatggagttccgatcggcacaccc
actgatgtgagctggcttttcaattatccaaagggtttgagagaccttctgctatattta
aagaagaaatataacagtccgaccatttacattacagagaatggggtggctgaagcaaaa
aatgcttcattgacggtaaaagaggcactcaaagatagcaccaggattagataccttgac
ggccacttaaagtgccttctaaaagcaattcaggagggtgttaacatgaagggtcactac
atgtgggcgtttttggatgacttcgaatggacttctggatatactcttaggttcgggttc
acatacactgattacaagaacaacttgagaagataccttaaatattcagcttattggttc
aagaagtttctccttaattaa

DBGET integrated database retrieval system