KEGG   Gossypium arboreum: 108481696Help
Entry
108481696         CDS       T05776                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gab01001]
    108481696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH DUF3098 YukC
Motif
Other DBs
NCBI-GeneID: 108481696
NCBI-ProteinID: XP_017640282
Position
7
AA seq 357 aa AA seqDB search
CQLNRSNELNRELIQIEEFLQSQNNLVPIRYSFKEIKKMTKNFKDKLGEGGYGSVFKGKL
RSGHHVAIKLLGKSKGNGQDFTNEVASIGRIHHANVVKLIGFCVEGSKQALVYDFMSNGS
LDKIIFTEENKNTLGWKKMFDIVLGVAQGIHYLHQGCDMQILHFDIKPHNILLDENFNPK
VSDFGLAKLYSVDDSIASLTAARGTIGYIAPELVYKNLGGISYKADVYSFGMLLMEMVGR
RKNVNAFADHTSQIYFPSWIYDRLDQGEDLELRDVSDDEKAMVKKMVITAFWCIQLLPSD
RPSMSKVLKMLEYDVELLKMPPKPFHQLPLETSMEVHSCENTNDELSTSLDTVTITS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
tgtcagttgaaccgatcaaatgagttgaatcgagaactaatccaaatcgaagagttcctt
caaagccaaaataatctggtgccaataaggtattcttttaaagaaattaaaaaaatgaca
aaaaattttaaagataaattaggtgaagggggttatggctcagtgtttaaaggaaagctt
cgtagtgggcatcatgtggcaataaaattgttgggcaagtcaaaaggtaatggccaagat
ttcacaaatgaagttgcttctattgggagaattcatcatgctaatgtggtaaaacttatt
ggattttgtgtggagggatcaaagcaagctctggtatatgacttcatgtctaatggatct
ttagataaaatcatatttacagaagaaaataagaacactttgggctggaaaaaaatgttt
gatattgtgcttggggtggctcaaggaattcattacttgcatcaaggatgtgacatgcaa
atcctacattttgatatcaagccacacaatattcttcttgatgagaattttaatccaaaa
gtttcagattttggtcttgctaaattgtattcagtagatgatagcattgcctctctcact
gcggcacggggaacgataggatatattgctcctgaattggtttacaaaaatcttggaggc
atctcatacaaagccgatgtttatagttttggaatgttgctgatggaaatggttggaagg
agaaagaatgtgaatgcatttgctgaccacactagtcaaatatattttccatcttggatt
tatgaccgattggatcaaggagaggacttggagttgagagatgtttctgacgatgaaaaa
gcaatggtaaagaaaatggtaataacagccttttggtgtatacaattactgccttctgat
cgtccttcaatgagtaaagtcttgaaaatgcttgaatatgatgttgaactccttaagatg
cctcctaagccattccatcaacttcctcttgaaacatcaatggaggttcatagttgtgag
aatactaatgatgagctaagtacatcattggatactgttactataacaagttga

DBGET integrated database retrieval system