KEGG   Gossypium arboreum: 108481937Help
Entry
108481937         CDS       T05776                                 

Definition
(RefSeq) insulin-degrading enzyme-like 1, peroxisomal isoform X1
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gab01002]
    108481937
Enzymes [BR:gab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     108481937
Peptidases and inhibitors [BR:gab01002]
 Metallo peptidases
  Family M16: pitrilysin family
   108481937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C TetR_C_3
Motif
Other DBs
NCBI-GeneID: 108481937
NCBI-ProteinID: XP_017640519
Position
7
AA seq 959 aa AA seqDB search
MAVSIEDVEILKPKTDKREYRRIVLKNSLQVLLISDPDTDKCAASLNVGVGSFCDPVGLE
GLAHFLEHMLFYASEKYPLEDSYLKYITEHGGSTNAFTASEMTNYFFDANTDCFEEALDR
FAQFFIKPLMSADATMREIKAVDSENKMYLLSDERRMSQLQKHLSLESHPYHKFGGGNCD
TLDVRPKAKGVDTRQELLKFYEDKYSANLMHLVVYSKESLDKIQSLVEDKFQEIQNSDRS
RFQFSSQPCTSEHLQILVRAVPIKQGHKLRIVWPITPSIVHYKEEPCRYLDHLINHEGEG
SLSYVLKKLGWATELYAGEDDRASEFSFFYVVIDLTDAGQDHMQEIIGLLFKYIQLLQQS
GVCKWIFDELSAICETGFHYEDKISPIDYVVRISSNMQIYPPKDWLVGSSLPSDFNPDTI
QKILNELSPESVRIFWESNKFEGLTDKVEPWYGTAYSIEKVSPSRIQAWMSSAPNENLHL
PVPNVFIPTDLSIKNPQEKIKLPVLLRKSSYSKLWYKPDTVFSTPKAYVKIDFDCPYVSN
SPETEALANLLATLLMDDLNEYAYYAQVAGLHYDISHTESGFQVTLVGYNHKLRILLETI
VNKIAKFEVRPDRFSVIKEMAIKAYQNFKFQQPYEQANDYYSLIIEDQTWPWMEQLEVLH
CLDEEDLAKFAPIMLSRAFLQCYIAGNIEHEEAVSMIEHIEDVFFKGSNPICQPLFPSQI
LRNRVVKLGKGMNYCYSKEGLNPSDENSALIHYIQVHRDDFILNVKLQLVALIGEQAAFH
QLRSVEQLGYITYLGQRNDFGIHGLLFIIQSTVKDPGHIDSRVEAFLRMFESKLSEMKND
EFKGNVNALINMKLEKHKSLSEESQFYWTEIISGTPKFDRREAEVEALKKLTQQELIDFF
DETIKVGATRKKTLSVRVYGNQHLAEYNSQKSEAVQPNTVQVDDIFSFRRSRPLYASFR
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcagcattgaagatgtggagattttaaagcccaaaacggacaaaagagagtac
cgaaggatcgtccttaaaaattcccttcaagttcttcttattagcgatcccgacaccgac
aagtgtgctgcttctttaaatgtgggtgttggttccttttgtgaccctgtcggcctcgaa
ggcctcgcccattttcttgagcacatgctgttttatgctagcgagaagtatcccttggaa
gatagctacttaaagtatataacagagcatggaggcagcacaaatgccttcacagcttct
gagatgaccaactatttttttgatgccaacaccgattgctttgaagaggctttggaccgg
tttgcacagttcttcattaaaccattgatgtcggctgatgctaccatgagggaaattaaa
gctgttgattctgagaacaaaatgtacttattgtctgatgagaggagaatgagccagctt
caaaaacatctaagcttggaaagtcatccatatcataaattcggtggagggaactgtgat
actttagatgttagaccaaaagcaaagggagttgacacaaggcaagaactccttaaattc
tatgaagacaaatattcagccaacctcatgcatctggttgtttattcaaaagaaagcctt
gataaaattcagagtctggtggaggataagttccaggaaatccaaaactctgatagaagc
cgtttccagttttcgagtcagccttgcacatcagaacaccttcagattcttgtcagagct
gttccaataaaacaaggccacaaattaaggattgtatggccaataactccaagcattgtt
cattacaaagaagagccatgcaggtatcttgatcatctcattaaccatgaaggagaagga
tcattgtcttatgtcttgaaaaaattaggatgggctactgaattgtatgctggtgaagat
gatagggcttcagagttttctttcttctatgtagtaattgatctgactgatgctggccag
gatcacatgcaagagataattggcttactatttaaatacattcagctgctgcagcaatct
ggtgtttgtaaatggatttttgatgagctgtcagctatttgcgagacaggatttcactat
gaggacaaaatctctcctattgactatgttgttcgtatttcttcaaacatgcaaatatat
cctccaaaagattggttggtcgggtcatcattgccttcggatttcaatccagacaccata
caaaagatactaaatgagctttctcctgagagtgttagaatcttctgggagtcaaataaa
tttgagggactgactgacaaggttgagccatggtatggtactgcatattccattgagaaa
gttagcccctcaaggattcaggcatggatgtcctcagctcctaacgaaaacctgcatcta
ccagtacctaatgtgtttataccaacagacttatcgattaagaatccacaagagaagatc
aagcttccggttttgttgagaaagtcatcctattcaaaattatggtacaagcctgataca
gtgttttctactccaaaggcatatgttaagatagactttgactgcccctatgttagcaac
tctcccgaaactgaggctcttgccaatcttttagcgacgttattgatggatgacttgaat
gaatatgcttattatgcccaggttgctggtcttcattatgatataagtcacacagaaagt
ggttttcaggtgactttggttggttataatcacaaactaaggatcttgctagaaaccata
gtcaacaaaattgcaaaatttgaagtgagacctgacaggttttcagtaatcaaggaaatg
gcaattaaagcctatcaaaatttcaagttccagcaaccctatgaacaggctaacgactat
tattcattaataatagaggatcaaacatggccttggatggaacaacttgaagttttgcat
tgtcttgatgaggaagaccttgcaaaatttgctccaatcatgctctcacgggccttttta
cagtgttatatagcaggaaacattgaacatgaggaggcagtatcaatgattgagcacatt
gaagatgtgttctttaagggttcaaaccctatatgccaaccgctgtttccatcccagatt
ctaagaaatagagtagttaaactaggaaaaggcatgaattactgctacagtaaggaaggc
cttaatccaagtgatgagaattctgctttaatccactatatccaggttcatcgggatgat
tttattttgaatgtgaaacttcagcttgttgctcttattggagagcaagctgccttccat
cagcttagatctgttgagcagctgggatatattacttacctaggccagaggaatgatttc
ggtatccatgggttgctgttcattatccagtctacagtaaaggatcctggacatattgat
tccagagttgaggcattcctcagaatgtttgagagtaaactgtctgaaatgaaaaatgat
gaatttaagggcaacgtaaatgcattgatcaatatgaagctcgagaagcacaaaagttta
agcgaagaatctcaattttactggactgagatcatcagtgggactcccaaatttgatagg
agggaagctgaggttgaagcattaaagaaacttacacaacaagaactgatagatttcttc
gatgaaactataaaagtcggtgcaactcgaaagaaaacacttagtgtgcgagtgtacggg
aaccaacatttggcagaatacaactcccagaaaagtgaagcagttcaaccaaataccgtc
caagtagatgatatctttagttttagaagatctcgaccactttatgcttcatttaggtga

DBGET integrated database retrieval system