KEGG   Gossypium arboreum: 108482605Help
Entry
108482605         CDS       T05776                                 

Definition
(RefSeq) pyruvate decarboxylase 2-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
gab  Gossypium arboreum
Pathway
gab00010  Glycolysis / Gluconeogenesis
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108482605
Enzymes [BR:gab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     108482605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-GeneID: 108482605
NCBI-ProteinID: XP_017641222
Position
7
AA seq 605 aa AA seqDB search
MDSTIGSQLQTCKPSNGMLGNPAQNGATILDSNAPPSVVVADATLGRHLARRLVEIGVKD
VFSVPGDFNLTLLDHLIAEPGLKNIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSI
INAIAGAYSENLPVICIVGGPNTNDYGTNRILHHTIGLSDFSQELRCFQTVTCYQAVVNN
LEDAHEQIDRAISTSLKESKPVYISISCNLPAIPHPTFTREPIPFSLSPRSSNKMGLEAA
VEAAATFLNKAVKPVIIGGPKLRVAKACEAFVELADACGYPIGVMPSAKGLVPEHHSRFI
GTYWGAVSTSFCAEIVESADAYLFVGPIFNDYSSVGYSLLVKKEKAIVVQPDRVVIANGP
AFGCVLMKDFLQALAKKVNRNPTAFENYQRIFIPDGVPNKSEPKEPLRVNIMFQHVQKML
SSSTAVIAETGDSWFNCQKLKLPEGCGYEFQMQYGSIGWSVGATLGYAQSVPDKRVISCI
GDGSFQVTAQDVSTMLRCEQKSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLVEAIHN
GEGNCWTKKVRNEEELIEAIGTATGEKKDCLCFIEVIVHKDDTSKELLEWGSRVCAANSR
PPNPQ
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggattccaccattggttctcagcttcaaacatgcaaaccttcaaacggcatgctaggg
aacccggcccagaatggagctacaatcctagattccaatgctcctccttccgttgtagta
gcagatgccacccttgggcgccacctggctcggcggcttgttgaaataggggtaaaggat
gtcttttccgtgcctggcgacttcaatctcacccttctcgatcatcttattgctgagcct
gggctcaaaaatattgggtgctgcaatgagctgaatgctggttatgctgctgatgggtac
gccaggtctcgtggggtaggtgcatgtgttgtcacgtttactgttggtggcctcagcatt
atcaacgctattgccggtgcttacagtgaaaatcttcctgttatttgcattgtgggagga
cccaataccaatgattatgggactaataggattctccatcataccatcggtttatcagat
tttagccaagagctaaggtgcttccagactgttacttgctatcaggctgtggtgaataac
ttggaagatgcgcatgaacagattgatagagccatttctacttctttgaaagagagtaag
cctgtatacatcagcataagttgtaatttgcctgcaatacctcatccgactttcactaga
gagcccatcccattttctctgtcacctaggtcgagcaacaagatgggtctagaagctgcc
gtagaagcagctgctacctttctgaataaagcagtgaaaccagtgatcataggagggcca
aaacttcgagtagcaaaggcatgtgaggcctttgttgaactggcagatgcttgtggctat
ccgattggcgtgatgccatcagcaaaaggattagtgccagaacaccactctcggttcatt
ggaacttactggggcgctgtgagcacttccttctgcgctgaaattgtggaatctgctgat
gcttacttatttgttgggccaatcttcaacgactatagctcggttgggtactcactcctt
gttaaaaaggagaaggccattgttgtgcagcctgatcgtgtagtcattgctaatggaccg
gcttttgggtgtgtcctaatgaaggactttctccaagcacttgcaaaaaaggttaaccgc
aacccaactgcttttgaaaactaccagcgtatattcattccagatggggttccaaacaaa
agtgaacccaaagaacctttgagggtcaatattatgtttcagcatgtacaaaagatgctt
tcaagtagcacagctgtgattgctgagacaggggattcctggttcaactgccagaagttg
aaactaccagaaggatgtgggtatgaatttcagatgcagtatggttcaattgggtggtct
gttggagcaacccttggatacgcacagtcggttccagacaagcgtgtcatttcttgcatt
ggcgatggaagcttccaggtgacggcacaggatgtatccaccatgctgcgatgcgaacaa
aagagcatcatattcttaattaacaacgggggatacaccattgaagttgagatccatgac
gggccttataacgttatcaagaactgggattacactggattagtcgaagcaattcacaat
ggtgaaggaaactgctggacaaaaaaggttcgcaatgaagaagagctgattgaagccatt
ggaacagccacaggtgagaagaaagattgcttgtgctttatagaagtcattgtacacaaa
gatgataccagcaaagagctgctggagtggggatcaagggtctgtgccgcaaatagccgt
ccaccaaatcctcagtag

DBGET integrated database retrieval system