KEGG   Gossypium arboreum: 108484036Help
Entry
108484036         CDS       T05776                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
gab  Gossypium arboreum
Pathway
gab00010  Glycolysis / Gluconeogenesis
gab00562  Inositol phosphate metabolism
gab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108484036
   00562 Inositol phosphate metabolism
    108484036
Enzymes [BR:gab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108484036
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108484036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 108484036
NCBI-ProteinID: XP_017643144
UniProt: A0A0B0MTC8
Position
8
AA seq 494 aa AA seqDB search
MAMAAILLLFLTLFSNSKADRDFDVRQHLSTVTRYGAVKDIVDNSFIPSDIPQGCTPIHL
NLVARHGTRSPTKKRVREMEKLASHIKELIEDAKQRNLSLQKVPAWFHNWESPWKGKLKG
GELDIKGEEELYQLGIRVRERFPDIFNEEYHPDVYPIKTTQIPRASASAVAFGMGLFSGK
GSLGPGRHRAFAVTSESRASDTILRFFECCQTYKDFRKNQEPSFNKLKEPILMEITSALA
KRYEFNFTIQDISSLWFLCKQESSLLDITDQACSLFSPTEVALLEWTDDIQMFMVKGYGK
SLNYRMGVPLLKDVLQSMSEAINADEDNQVPGSYEKARLRFAHAETVVPFSCLLGLFLEG
SDFERIQKEEPLDLPPKPPQKRNWRGSIVAPFAGNNMLVLYSCPANSSSKYFVQVLHNEH
PIPMPGCGGTDFCPFQVFKDKIVEPHFIHDYDTLCNAHLDESKHKPETSKLSQLFRWIFR
LGGNDDTPSHGVEL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcagcaattttgttgctgtttttaacgttattttcaaattcaaaagctgat
cgagatttcgatgttcgtcaacacctctctactgtaacaagatatggtgctgtgaaagat
attgttgacaattcgtttataccatctgatattcctcaaggctgtactcctatccactta
aatcttgtggcaagacatggaacgcgttctcctacaaagaagcgggtgagagagatggaa
aagttggcttctcatataaaggaacttatagaagatgccaaacagaggaatttgtcctta
caaaaagtccctgcttggtttcataactgggagtctccttggaaagggaaactgaaaggt
ggagagttggatatcaaaggagaagaggaattgtatcagcttggaatcagggttagggaa
agatttcccgatatatttaatgaggaataccaccccgatgtgtatcccataaagactact
caaattcctcgggcttctgctagtgctgttgcatttggcatggggctatttagtggaaaa
ggaagtctaggtccaggtcgtcatcgagcatttgctgttacaagtgaaagtcgagcaagt
gacacaatcctgaggttttttgagtgttgtcaaacctacaaggacttcaggaaaaaccaa
gagccttctttcaataagctgaaagaaccgatcctgatggagattacctctgcattggct
aagcggtatgagttcaattttacaatacaggatatatcctctctttggtttctgtgtaaa
caggaatcatccttgttggatataactgatcaagcttgcagtcttttcagtcccactgag
gttgctttgttggagtggacggatgatatacagatgttcatggtaaagggttatggtaaa
tcattaaattatagaatgggagtgcctttgcttaaagatgttctgcaatccatgtcagaa
gctatcaacgctgacgaagataaccaagtacctggcagttatgagaaggcaagattgcgt
tttgcacatgcagaaactgtagttcctttttcgtgcttgcttgggcttttccttgaagga
tctgattttgagcgaatacaaaaggaggagcctttggatctccctcctaagcctccccag
aaaagaaattggagaggcagcattgtggcaccttttgctgggaataatatgctggtctta
tatagctgtccggctaattcttcaagcaaatactttgtgcaagttctacacaatgagcat
cccatcccaatgcctggttgtggcggtaccgacttttgtccatttcaagttttcaaggat
aaaattgtcgaaccccattttatccacgactacgataccctttgcaatgcacatcttgat
gagtcaaagcataagcctgaaaccagtaagttatcacaactgttccgttggatctttcgg
ctgggggggaatgatgatacaccatcccacggagttgaattgtag

DBGET integrated database retrieval system