KEGG   Gossypium arboreum: 108486498Help
Entry
108486498         CDS       T05776                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gab  Gossypium arboreum
Pathway
gab00970  Aminoacyl-tRNA biosynthesis
gab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gab00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108486498
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gab03029]
    108486498
Enzymes [BR:gab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     108486498
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     108486498
Mitochondrial biogenesis [BR:gab03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    108486498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 108486498
NCBI-ProteinID: XP_017646070
Position
8
AA seq 543 aa AA seqDB search
MLSTIQPPRYLSRFPLRGRTKSRPFHILSSAQPVTKTSFAADQSQILSIRYSLLNRHLSA
VELTHSYLNRLKQTEPHISCFLHISDPDKVLKQAQDIDDKIKRNEEVGPLAGVLVAIKDN
ICTADMPSTGGSYILEGYRPPFDATAVKRLKDLGAIVVGKTNLDEFGMGSTTEASAFKVT
ANPWDLSRVPGGSSGGSAASVSARQCVVSLGSDTGGSVRQPASFCGVVGLKPTYGRVSRF
GLMAYASSLDVIGCFGSSVADTGILLHAISGHDSLDATSSKREVPDFTSQFTSASSLKSR
PLEGLRVGLIRETVDAGVDSGVKSAIQGAAAHLEQLGCVLKEVSLPSFSLGLPAYYILAS
SESSSNLSRYDGVRYGNQASSDELNALYEESRAKGFGSEVKMRILMGTYALSAGYYDAYY
KRAQQVRTIIRKSFKAALDENDILISPAAPSAAYKIGEKKNDPLAMYAGDIMTVNVNLAG
LPALVLPCGFVEGGAVGLPVGLQIIGAAFDEEKLVKVGHIFEQTLEGYNFVPPLITDVGG
ASA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgctatcaacaattcaacccccgcgttatctttctcgtttcccactccggggccggacc
aaatcccgcccctttcacatcctttcttccgcacagcccgtcaccaagacctccttcgca
gcagaccaatcacaaatcctctccattcgatactcgcttctcaaccgtcacctcagtgct
gtggaactgacccattcctacctgaaccgtctcaaacaaacggagccccatatcagctgt
ttccttcacatctctgaccctgacaaggtcctgaaacaagcgcaggatattgacgacaag
ataaaaaggaatgaagaagtgggtccccttgctggtgtcctcgtcgctatcaaagacaac
atttgtactgctgatatgccttccactggtggctcttacatcctggaaggctaccgtcct
ccgttcgatgccactgccgtgaagaggttgaaggacttgggcgccattgttgttggaaag
accaacttggatgagtttggtatggggagtactactgaagcttctgcatttaaggtgaca
gcgaacccatgggacctttctcgggtgccagggggatcttcgggtggctctgctgcatct
gtatctgccaggcaatgtgttgtgtcacttgggagtgacactggtggaagtgtgaggcaa
ccagcatcattttgcggtgtagttggtttgaagccaacttatggacgtgtttcaagattt
ggacttatggcatatgcgtcatcccttgatgttatcggatgttttggttcctccgttgcc
gacaccgggattcttcttcatgcaatttctggtcatgattcacttgatgctactagcagt
aaacgagaggtgcctgacttcacttctcagttcacttctgcaagttctttgaaatccaga
ccattagaggggttaagggttggtcttatccgtgaaactgttgatgctggtgttgattct
ggagttaaatcagcaattcagggtgctgcagctcatctggaacaattaggatgtgttttg
aaagaggtttcattgccatccttctctcttggtttgccagcttactatattcttgcatca
tcagaatcatcttcaaacttatcaagatatgatggtgtcagatatgggaatcaagcttct
tctgatgagctaaatgccctttatgaagaatcgagggctaaaggatttggatcagaggtc
aaaatgagaatattaatgggaacatatgcgctttcagctggatattatgatgcatattac
aagcgtgctcaacaggtaaggaccataattcggaaaagcttcaaggcagcattggatgaa
aatgacatcctgatttcacctgcagctccatccgctgcatataagattggtgagaagaag
aatgacccattggcgatgtatgccggagatattatgactgtgaatgttaacttggcgggc
ttacctgcattggttttgccatgcggatttgttgaagggggagctgttggccttcctgtt
ggccttcaaatcattggtgcggcatttgatgaggaaaagttggtaaaagtgggtcacatc
tttgagcagactcttgaaggttacaattttgtccctccgctcatcacggatgtgggtggt
gcttcggcctga

DBGET integrated database retrieval system