KEGG   Gossypium arboreum: 108488791Help
Entry
108488791         CDS       T05776                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108488791
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     108488791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 108488791
NCBI-ProteinID: XP_017648566
UniProt: A0A0B0P5R5
Position
9
AA seq 585 aa AA seqDB search
MRSFNFFGRLCTAFHDYPSLSKIIVVSTLSSGSLIAYSEANTNNGNRGRVAHADAVASKK
KKVVVLGTGWAAMTFLKNLNNCIYEVEVVSPRNFFLFTPLLPSVTCGKVEARSIVEPIRN
IIRKKHFDVRYREAECTKIDPANNKIYCRATANTNSKRREEFAIDYDYLIIAVGAQVNTF
NTPGVEGNCHFLKEIDDAQKIRRNVIDAFEKASLPNLTEEERKKILHFVVVGGGPTGVEF
AAELHDFVNEDVVKLYPMVQNFVKITVLEATDHILNMFDKRITKFAEHKFGRDNIEVKLG
SMVTKVTENEICTKAKGSDKTTSMPYGMVLWSTGIGPRPIVKDFMKQIGQGNRRALATDE
WLRVEGVGNVYALGDCATINQRKVMEDITEIFKKADADNSGTLTLKEFQDISNDICERYP
QMQLYLKSKPVRNIFDRPSQVKGKASKESIELRIEEFKSALSEVDTQLKNLPATAQVANQ
QGAYLAKCFNRMEECEINPEGPTRIRGTGRHRFRPFRYRHLGQFAPLGGEQTAAQLPGDW
VSIGHSSQWLWYSIYASKQVSWRTRALVVSDWIRRFIFGRDTSGI
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcttcaatttcttcggtagattatgtacggctttccatgactatccttctctt
tctaagatcatcgtcgtctctacactcagtagcgggagccttatagcttattctgaggca
aacacaaacaatggaaatagaggccgtgttgctcatgctgatgctgtcgcatccaagaaa
aagaaggtggtggtgctcggaactggttgggcagcaatgactttcttgaagaatctcaat
aactgtatttacgaggtggaagttgtgtctcctcgtaatttctttctctttaccccatta
ctaccgagtgttacttgcggtaaagtagaagctcgtagcatcgttgagccaattcgcaac
atcatcagaaagaaacattttgacgtcagataccgtgaagctgaatgtaccaaaatagat
ccagcaaataataaaatttactgccgtgccactgcaaataccaattcaaagcggcgagaa
gagtttgcaatagactacgactaccttattattgctgttggagctcaggttaacaccttt
aacacccctggtgtcgagggaaattgccatttcttaaaggaaattgatgatgctcagaag
attcggaggaatgtcattgacgcctttgagaaggcaagcctaccaaatttaactgaagag
gagagaaagaaaatccttcactttgtggttgttggtggtggccctacaggtgtggaattt
gctgctgaacttcatgattttgtgaacgaagatgtggtcaaactatatccaatggtccaa
aactttgtgaaaataactgttcttgaggccacagatcatattttgaacatgtttgacaaa
agaatcacaaagtttgctgaacacaaatttggaagagataatattgaagtgaaattagga
tcaatggttacaaaagtgactgagaatgaaatttgtacaaaagcaaaaggtagcgacaaa
acaacttctatgccatatggaatggttctctggtcaaccggcattgggccacgtccaatc
gtaaaggactttatgaagcaaattggtcagggtaataggcgtgctttagcaactgatgaa
tggctaagagtagagggagttggtaacgtttatgcacttggtgactgtgcaactattaac
caacggaaagtcatggaagacataacagaaatatttaagaaggcagacgcggataactcg
ggaacgctgacactcaaggaatttcaagatatcagtaatgatatttgtgaaagataccct
caaatgcagctttatctgaagagcaaaccagtgcgtaacattttcgatcgtccatcccaa
gtcaaaggaaaagcttcaaaagaatccattgagctgcgtattgaagaatttaaatctgct
ctttccgaagttgatactcagttgaagaatctgcccgcgactgcacaggttgcaaatcaa
caaggtgcgtatctcgctaagtgcttcaatcgtatggaagagtgtgaaattaatcctgaa
ggtcccactaggatcaggggaacaggtcgccatcgtttccgtccctttaggtacaggcac
ttgggacaatttgctcctttgggaggggagcaaacagctgcacaacttcctggtgattgg
gtctcaatcggacacagctcgcagtggctctggtattccatctatgcaagcaagcaagta
agctggcgcacaagggcattggtggtctcggactggatacgacgttttatttttgggagg
gataccagtggtatttaa

DBGET integrated database retrieval system