KEGG   Gossypium arboreum: 108489580Help
Entry
108489580         CDS       T05776                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog MMK1-like isoform X1
  KO
K14512  mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
gab  Gossypium arboreum
Pathway
gab04016  MAPK signaling pathway - plant
gab04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:gab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    108489580
   04075 Plant hormone signal transduction
    108489580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gab01001]
    108489580
Enzymes [BR:gab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108489580
Protein kinases [BR:gab01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108489580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 108489580
NCBI-ProteinID: XP_017649717
UniProt: A0A0B0N601
Position
9
AA seq 398 aa AA seqDB search
MEGGGRPQPPDTQMAEAAPPQQPVYQNALPLMFPRMQIPATPSYGGRFTQYNIFGNIFEV
TAKYKPPIMPIGEDAYGTVCSALNSETNESAAIKKIVNAFGNKVDAKRTLREIKLLRYMA
HENVVAIRDVIPPPQRECFNDVYIVYELMDTDLHQLICCNQKFNEEHYQYFIYQILRGLK
YIHSANVLHRDLKPSNLLVNENCDLKICDFGLARVNTESDFMTEYVITRWYRPPELLLYS
SQYSAAIDMWSVGCIFMELFIRKPLFPGRDHLHQVRLLLELLGTPSEAEMEYVNENAKRY
IQQLPNYPRQSFSEKFPNVHPLAIDLAQKMLTFDPKQRITVEEALAHPYLTALHDISDEP
VCMIPFSFDFEQHALTMAQMKELVYEEALAFNPDYSLQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaagggggagggcgacctcagccgcccgacacccagatggcggaggcagctccgccg
cagcaacctgtctaccaaaatgcacttcctctaatgtttccccggatgcaaattcccgcc
actcctagctatggcggcaggtttactcagtataacattttcggcaacattttcgaggtc
actgctaaatataaaccccctattatgcccatcggtgaagatgcctacggcaccgtttgt
tctgcgttgaattccgagacaaatgaaagcgcggcaataaagaagatagtgaatgcgttt
ggtaacaaggttgatgcaaagagaactcttcgtgagatcaagctgcttcgctacatggcc
catgagaacgttgttgcaatcagggatgtaattccacctcctcagagggaatgctttaat
gatgtttatattgtatatgagctgatggacactgacctgcatcagctaatctgttgtaat
caaaagttcaatgaagagcattatcagtatttcatctatcaaatcttacgtggcctgaag
tatatacactctgcaaatgttctacatagggacttaaaacctagcaaccttctcgtgaat
gaaaactgtgacttgaaaatatgtgattttggactggctcgtgtcaacactgaaagtgat
tttatgacagagtatgttattactagatggtaccgtcctccagaattgctgctatattct
tcacaatattctgcagccattgatatgtggtcagtgggttgcatttttatggaactgttt
attcggaagccattatttccgggaagggatcatttgcatcaggtgcgattgctgttggag
ctacttggcactccatcagaggctgaaatggaatacgtgaatgaaaatgctaagagatac
attcaacaacttcctaactatccccgacaatctttctctgagaagttcccaaatgtccat
cctttagctattgatcttgctcaaaagatgttaacatttgatcctaaacaaaggattact
gttgaggaggcccttgctcacccctatctaacggcactgcatgacataagcgatgagcct
gtttgcatgatcccctttagctttgactttgagcagcatgccttaaccatggcgcagatg
aaggagttagtatatgaagaggcacttgcattcaacccagactattcattgcagtaa

DBGET integrated database retrieval system