KEGG   Geoglobus acetivorans: GACE_0072Help
Entry
GACE_0072         CDS       T03507                                 

Definition
(GenBank) geranylgeranyl reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
gac  Geoglobus acetivorans
Pathway
gac00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gac00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GACE_0072
Enzymes [BR:gac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     GACE_0072
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     GACE_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_oxidored Pyr_redox_2 FAD_binding_2 Trp_halogenase DAO Lycopene_cycl HI0933_like NAD_binding_8 GIDA Thi4 Pyr_redox Pyr_redox_3 AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIY89132
UniProt: A0A0A7GDW2
Position
complement(57889..59061)
Genome map
AA seq 390 aa AA seqDB search
MTDYDVVVVGAGPAGSIAAKTAAEKGLDVLLIEKRQEIGVPVRCAEGVSREGLEKFVNPD
SKWIASEIENAEIISPSNHKVVLSAENAGNEVGYVLERKIFDRYLARLASKAGADVLTKT
SAVSFKRENGTVKLGIRSMGEFSEITAKIVIGADGVESRVAKWAGIDTTLKLNEIESCVQ
YLMTNIEFDDDTTYFWVGRKYAPGGYIWLFPKGKDAANVGIGVMPSLAEKSAKWYLDRFV
EEHFPEGEIVEVVVGGVPVKGAIDTAVADNVMLAGDAARHTDPITGGGIINAMSAGHHAA
IAAYEAIKAKDYSKETLKRYDEKWKSDFGESLVRNKKLQEKMMRLDDPTLDRLAKSLEGM
PIEEMSVRRLAFELFKKHPRLLWDLREFIV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgactgactacgatgttgttgtcgttggagcagggcctgccggaagcatagctgcaaaa
actgccgctgagaaggggcttgacgtcctgctgattgaaaaaaggcaggagataggcgtt
ccagtaagatgtgctgaaggtgtgagcagagaaggacttgaaaagtttgtaaatcccgac
agcaagtggattgccagtgagatagaaaatgcagaaatcatctctccctcaaaccataaa
gttgttctctccgctgaaaatgccggaaatgaggttggatacgtccttgaaagaaagatt
tttgacagatatcttgcaagactcgcctccaaagccggtgcagatgttttgacgaagaca
tccgcagtatcgttcaaaagagaaaacggtacagtaaagctcgggataaggagtatgggc
gagttcagcgagattaccgcaaagattgttataggtgcagatggtgtagagagcagggtt
gcgaagtgggccgggatagacaccactctgaagctgaatgaaatagaaagctgcgtgcag
tatctcatgaccaacatagagttcgatgatgacacgacctacttctgggttggcagaaag
tacgctccgggtggctatatctggctgttccccaagggaaaagatgcagcgaatgttggt
attggcgttatgccaagtctcgcagagaaaagtgcaaaatggtatcttgacaggtttgtc
gaggaacattttcctgaaggggagatagtcgaagttgttgttggcggtgtgccggttaaa
ggggcaatcgatactgcagtggcagacaacgtcatgctcgcaggtgatgctgccaggcac
acggacccaataacaggaggtggaataatcaatgcaatgagtgctggccatcacgcggcc
atagccgcttatgaagctatcaaagcaaaggactacagcaaagagactctgaaaaggtac
gacgaaaaatggaagtcggacttcggagagagtctcgtgagaaacaaaaagcttcaggaa
aaaatgatgagactcgatgatccaacactggacaggctggcaaaaagtcttgaaggtatg
ccaatcgaagagatgagtgttaggagacttgctttcgagctgtttaaaaaacatccaaga
cttctgtgggatctgagagaattcatagtttaa

DBGET integrated database retrieval system