KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0154Help
Entry
Glaag_0154        CDS       T01483                                 

Definition
(GenBank) Inositol phosphatase/fructose-16-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00010  Glycolysis / Gluconeogenesis
gag00030  Pentose phosphate pathway
gag00051  Fructose and mannose metabolism
gag00680  Methane metabolism
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01120  Microbial metabolism in diverse environments
gag01130  Biosynthesis of antibiotics
gag01200  Carbon metabolism
Module
gag_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glaag_0154
   00030 Pentose phosphate pathway
    Glaag_0154
   00051 Fructose and mannose metabolism
    Glaag_0154
  09102 Energy metabolism
   00680 Methane metabolism
    Glaag_0154
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gag04147]
    Glaag_0154
Enzymes [BR:gag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Glaag_0154
Exosome [BR:gag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Glaag_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: AEE21123
UniProt: F4AHJ4
Position
complement(179659..180630)
Genome map
AA seq 323 aa AA seqDB search
MKRLNSQLQEDGAPMELILLLRTLLAGCKEISFRVSQGALAGVLGSTLSENVQGETQKKL
DVISNQILKDILSESGYVKAISSEEEDDVVACNPNGNYLVSFDPLDGSSNTDINSLIGTI
FSITHAPQWMDADDPSAFLQPGTQIVAAGYVLYGPSAMLALSTGRGTHLYTLDKTHGGFL
LTQKNIQVPTQTSEFAINTSNQRHWEDPVQNYIGDLIAGTDGPRDKDYNMRWVAAMVGDI
HRVLSRGGIFLYPFDKRNPEMPGKLRLLYEANPMAFLMEQAGGLASTGHGRILEVMPTEI
HQRVPVILGSKEEVETCLSYYNA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagactcaactcgcaacttcaagaagacggcgctccaatggagcttatcctgcta
ttaagaacattattagcgggatgtaaggaaatatcattcagggtcagtcagggcgcatta
gctggtgttttagggtcaaccttaagtgagaatgtacaaggcgagacacaaaagaaactt
gatgttatttctaatcaaattctaaaagacatactcagtgaatctggttatgtgaaagcc
atttcatctgaagaagaagatgatgttgtggcctgtaatccgaacggaaactacttagtc
agttttgatccattggatggctcatcaaataccgacattaacagcttaatcggaactata
ttctcgattacccatgcgccacaatggatggatgcagacgacccctcagcgtttttacaa
ccaggtacgcaaattgttgccgcaggctatgtgttatatggcccaagcgccatgctcgca
ttaagcacaggtcgcgggacccatctatatacgttagataaaacccacggcggctttttg
ttaacgcaaaaaaatattcaggtgcccacacaaacgtctgagtttgcgattaacacctca
aatcaacgccactgggaagatccggtgcaaaactacattggtgacttgattgcgggtacc
gatgggcctcgtgataaagactacaatatgcgctgggtcgcggccatggtaggtgacata
cacagagtactcagtcgtggggggattttcttgtatccatttgataaacgtaaccctgaa
atgccgggcaaactgcgtttactatatgaagcaaatccaatggcttttttaatggaacaa
gctggcgggctagcctcaacaggtcatggcagaattttggaagtcatgcccactgaaatt
catcagcgcgttccggttatcttaggttccaaagaagaagtagaaacctgcttgagctac
tacaacgcttaa

DBGET integrated database retrieval system