KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0158Help
Entry
Glaag_0158        CDS       T01483                                 

Definition
(GenBank) NAD(+) diphosphatase
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00760  Nicotinate and nicotinamide metabolism
gag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Glaag_0158
Enzymes [BR:gag01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     Glaag_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX zf-NADH-PPase NUDIX-like DZR
Motif
Other DBs
NCBI-ProteinID: AEE21127
UniProt: F4AHJ8
Position
complement(184464..185279)
Genome map
AA seq 271 aa AA seqDB search
MIKQNVNVNADTPSIWFIFSAEKLLVPHEAQGPLIESWNNLGFAHAYKEQIVQVGEHNEQ
MCYLIDMGNEVIEHSGVQLAHLRSLLLHDDLELFSVAARAWQVALFLRTHRFCGQCGSTM
QKIDWEMAMQCHRCHHRCYPRISPCIIVAIRHEDKILLAQGKPQKDRNMFSTLAGFVESG
ETLENAVHREVFEEVGVAIKNLRYMSSQPWPFPHSLMVGFLADFDSGDIKVDGHEIIEAH
WFKYDELPNIPPKFSIAGQLIERTIEEICAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacaaaacgtaaacgttaacgccgacacccccagtatttggtttatctttagc
gccgaaaaacttctcgttccccatgaagcacaaggccccttgatcgaaagctggaacaac
cttggctttgcccacgcttataaagaacaaatagttcaagtaggtgaacataacgagcag
atgtgctacctcattgatatgggaaatgaggttattgagcatagcggtgtacaattggct
catcttagaagtttattacttcacgatgacctagaactcttctctgtggctgcacgcgca
tggcaagtagcactttttttaagaacgcacagattttgtggtcagtgtggctcaaccatg
caaaaaatcgattgggaaatggcgatgcaatgccatcgctgtcatcatagatgctaccca
agaatatcaccttgcatcattgtcgctattcgccacgaagataaaatcctgttagcgcaa
ggcaagccacaaaaagaccgaaatatgttctctacgctggctgggtttgtggaaagcggt
gaaaccctagaaaacgcggttcatcgggaagtatttgaagaggtcggcgtcgcaatcaaa
aacctaagatatatgtcgagtcaaccttggccatttcctcattcgttaatggtaggtttt
ctcgctgattttgacagtggcgatatcaaagtcgatggtcatgaaataatcgaagctcat
tggtttaaatatgatgaacttcctaatattccgccaaagttttctattgcagggcagcta
attgaacgcacgatagaagaaatttgcgcagagtaa

DBGET integrated database retrieval system