KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0188Help
Entry
Glaag_0188        CDS       T01483                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00361  Chlorocyclohexane and chlorobenzene degradation
gag00625  Chloroalkane and chloroalkene degradation
gag01100  Metabolic pathways
gag01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Glaag_0188
   00361 Chlorocyclohexane and chlorobenzene degradation
    Glaag_0188
Enzymes [BR:gag01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Glaag_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Put_Phosphatase Hydrolase_6 PNK3P
Motif
Other DBs
NCBI-ProteinID: AEE21157
UniProt: F4AHM8
Position
217084..217767
Genome map
AA seq 227 aa AA seqDB search
MAQAAPKPKVIIFDVNETLLDLETMRTSIGEALDGQEELTTLWFSTMLHHSLVTTVTGDY
QDFGKIGVAALMMVAQNNDIEITEEQAVTAIKTPLLSLPAHPDVKAGLKALKEQGFKLVS
LTNSSNKGVETQFKNAGLTDYFDKRMSIEDIKVYKPDLRAYAWALEQLNIKPEEALMVAA
HGWDVAGAKAAGLQTAFVARPGKALYPLAQKPDYVVKDLSELVEILK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagcagcccctaagccaaaagtaattattttcgatgtgaatgaaacgctactt
gatttagaaaccatgcgcacctctattggtgaggcgctagatggtcaggaagagcttaca
acattgtggttttccacgatgctacatcattctctagtcactaccgtcactggtgattat
caggacttcggtaaaatcggcgtggcggcactgatgatggttgctcaaaataacgatatt
gagatcaccgaagaacaagctgtgacagcaattaaaactcctttgttgtcgctccctgct
catccagatgtaaaagcaggtctaaaagcgcttaaagagcaaggcttcaaactggttagc
ctgaccaattcgtcaaataaaggggttgagactcagtttaaaaatgccggtttaaccgac
tattttgataagcgcatgagtattgaagatatcaaagtttacaaaccagaccttcgcgct
tatgcgtgggcacttgaacaattaaacatcaaaccagaggaagccttaatggtggctgct
catggttgggatgtcgccggagctaaagccgcagggttacaaactgcctttgtggcacgc
ccaggtaaggcgctttatccgttagcgcaaaagcctgattatgtcgtaaaagacttaagc
gaattggttgaaatacttaaataa

DBGET integrated database retrieval system