KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0316Help
Entry
Glaag_0316        CDS       T01483                                 

Definition
(GenBank) cell wall hydrolase/autolysin
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:gag00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Glaag_0316
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gag01011]
    Glaag_0316
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gag03036]
    Glaag_0316
Enzymes [BR:gag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     Glaag_0316
Peptidoglycan biosynthesis and degradation proteins [BR:gag01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   Glaag_0316
Chromosome and associated proteins [BR:gag03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    Glaag_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 AMIN LysM
Motif
Other DBs
NCBI-ProteinID: AEE21285
Position
complement(353216..354553)
Genome map
AA seq 445 aa AA seqDB search
MKYLRPISLSVLLSILLLLVVPVSFAKNAIDSVRIWPSPGSTRIVFDLEDTPQYSYFTLS
NPNRLVIDLADTKKNFDFAKLANKSPLVKKLRYSSAKDKSGIRVVIELNKKLDSNLFALP
PTEPYRNRLVIDLDDKNAPASAPTVVKHNNTQQSRDIVIVIDAGHGGEDPGSIGRGGTFE
KNITLNVAQRLAKLIDAEPGMKAVMTRSGDYYISPNKRPDIARKHKADLLISIHADAFTT
PQPRGASVWVLSMRRANTELGRWMEKSERHSELLGGAAEVIQDTASERYLTQALLDMSMD
HSLTTSYDLSRKVIGKLRGITRMHKKIPQAASLAVLTSPDIPSILVETGFISNPSEEKNL
NWSKFRQQLATSIFSAVKTHFSESPPDDSLWAKQKRHTRTHKVRSGESLSLLAQRYNVNV
GAIKAANNLRSDVVRIGQVLTIPRT
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatctgcggccaatatcattatcagtgctcctcagcattttattgctgttggtt
gtgccggttagttttgctaaaaatgccatagatagcgttcgtatttggccatcacctggt
agtacgcgcattgtttttgatctcgaagataccccgcaatacagctacttcaccctgagc
aacccaaatagactggtcattgatttagccgacaccaaaaagaattttgatttcgccaaa
ctagcaaataaaagccccttggtgaaaaagcttcgttatagctcagccaaagacaaaagc
ggtattcgggtcgttatcgaactcaacaaaaaactcgatagtaatctgtttgccttgccc
cctactgagccctatcgtaatcgcttagtaatagatttagatgacaagaatgcaccggct
tcggcccctactgtggtcaaacataataatacccaacaatctcgcgatatcgtgattgtg
attgatgctggtcacggtggtgaagatccaggctcgataggacgcggcggcacattcgaa
aaaaacatcacgttaaatgttgctcagcgcctggccaagctaatcgatgctgagcctggt
atgaaagcagttatgacacgttcaggtgattattatatttcacccaataagcgccctgat
attgctcgcaagcataaagcagatttgctcatctcgattcacgctgatgcatttaccact
ccgcagcccagaggagcttcggtttgggtactgtctatgcgccgcgccaacacagaactt
ggtcgctggatggaaaaatctgaacgtcattcagagttattaggtggtgcagcagaggtt
attcaagacaccgcgagtgagcgctatttaacccaagccttgttagatatgtcgatggat
cattccctaaccaccagttacgatttaagccgaaaggtaataggtaaattgcgcggcatt
accagaatgcacaagaaaattcctcaagctgccagtctagcggtattaacctcaccggac
attccttctatcttggtagaaacaggttttatctctaacccttcagaagaaaaaaatcta
aattggtctaagtttcgtcagcaactagcgacgtctatcttcagtgctgtcaaaacccac
ttttctgaatcgccgcctgatgattccttatgggccaaacagaaacgccatacccgcacc
cacaaagtacgtagtggtgaaagcctttcgttacttgcccagcgctacaatgtcaatgtt
ggagcaattaaggccgccaacaatttacgctcagacgttgtgcgtattgggcaagtcctg
actattcctcgcacttag

DBGET integrated database retrieval system