KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0931Help
Entry
Glaag_0931        CDS       T01483                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Brite
KEGG Orthology (KO) [BR:gag00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Glaag_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 HTH_11
Motif
Other DBs
NCBI-ProteinID: AEE21893
UniProt: F4AQH5
Position
complement(1100447..1100848)
Genome map
AA seq 133 aa AA seqDB search
MTTPFVSGHELSDKINVSVNTQHLPEHAANEADKYAFAYEITIANNSHESVQLINRYWLI
IDGNGKQSEVEGAGVIGQQPQIDSGNSFQYTSGAVLDTPVGSMQGFYEMQDKDGALFRVP
IDIFRLAVPHQIN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacctttcgtttctggtcacgagctaagtgacaaaatcaatgtgagtgtcaat
acccagcatttgccggagcatgctgctaacgaagcagacaaatatgccttcgcatacgaa
attaccatagccaacaatagccacgaaagcgtgcaactgatcaatcgttattggctgatc
attgacggaaatggtaagcaatctgaagttgaaggtgcgggcgtaatcggccaacaacct
caaatagacagtggtaacagttttcagtataccagtggcgcagtgctggataccccagtt
ggctctatgcaaggtttctacgaaatgcaggacaaagatggcgcgctgtttcgtgtgccc
attgatatttttcgcctagctgtgcctcatcaaatcaattaa

DBGET integrated database retrieval system