KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0999Help
Entry
Glaag_0999        CDS       T01483                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00010  Glycolysis / Gluconeogenesis
gag00020  Citrate cycle (TCA cycle)
gag00620  Pyruvate metabolism
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01120  Microbial metabolism in diverse environments
gag01130  Biosynthesis of antibiotics
gag01200  Carbon metabolism
Module
gag_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glaag_0999
   00020 Citrate cycle (TCA cycle)
    Glaag_0999
   00620 Pyruvate metabolism
    Glaag_0999
Enzymes [BR:gag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Glaag_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_D23 Cytomega_UL84
Motif
Other DBs
NCBI-ProteinID: AEE21960
UniProt: F4AQP2
Position
complement(1178017..1180023)
Genome map
AA seq 668 aa AA seqDB search
MSDMKDVLVPDVGGEEVEVIEVLVAVGDDVDAEASLITVESDKASMDIPAPFAGTISDIS
VKVGDKISQDQLIMKMSSGADAPQEEEAPEPAKTEAKSEEPAPAKEEAQSSSSASQVIEV
TVPDIGGDTDVEVIEILVSAGDSIEEETGLVTLETDKATMDVPSPKAGVVKEVKLSTGDK
VSEGSLVILLEVAGSAPAQTESASQETQAAPAQEQKQEQAASAPDEEEQASGEPETIEVT
VPDIGGDTDVEVIEVLVAVGDKIEEETGLITLETDKATMDVPAPKAGVVKELKISVGDKV
SEGSVVLMLEVAGSAPKAAPKTESKAPAQQAAQTSAPAQNTPKSAPVPHHPSAGERGKAG
KVHASPSVRRVAREFGVDLTQVKGTGPKNRVLKEDVQSYVKYELSRPKMTAGSSVNNGGG
GLQVLAPPKVDFSKFGEVEEIPLTRIQKISGPNLHRNWVTIPHVTQFEEADITDLEAFRK
QQNAVAEKKKLGFKITPLVFMMKAVADALKAYPVFNSSLSESGESLIQKKYFHVGIAVET
PNGLVVPVVRDVDKKGIYDLSKELMEISIKARDGKLKAADMQGSCFTISSLGGIGGTAFT
PIVNAPDVAILGVSKSEMKPKWNGKDFEPRLMLPLSLSYDHRVIDGAVAARFAVHLGKVL
GDLREMLL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatatgaaagatgtattggtacccgatgttggtggcgaagaagtagaagtcatt
gaagtacttgtcgccgttggtgacgatgttgacgcagaagcatccctgatcacagtggaa
agcgacaaagcgagcatggatattcctgctcctttcgctggcacaatcagcgatatttca
gtcaaggttggtgacaaaattagccaagaccaattgatcatgaaaatgtccagtggtgct
gatgcaccacaggaagaagaagcaccagagccagcgaaaacagaagcaaaatctgaagag
ccagcacccgctaaagaagaggctcaatcgtcttcatcagcttcacaagtgattgaagtg
actgtcccagatattggtggcgacactgatgttgaagtcattgaaattctcgtaagcgct
ggtgatagtatcgaagaagaaactggccttgttaccctagaaacagacaaagcaacaatg
gatgtcccttcacctaaagcgggtgtagtgaaagaagttaagctgagtaccggtgacaaa
gtatcggaaggctcgcttgtgatattgctagaagtagcaggtagtgcaccagcacaaacc
gaatcagcttctcaagaaacacaagcagccccagctcaagagcaaaagcaagagcaagct
gccagtgcccccgacgaagaagaacaagcgtctggtgagccagaaacgattgaagtgacg
gtacctgatatcggtggtgacaccgatgttgaagtgatcgaagtacttgtagcggttggc
gataaaatcgaagaagaaaccggtttaatcacacttgaaacagataaagccactatggac
gttccggcccctaaagccggtgtcgtcaaagagcttaaaatcagtgtcggcgacaaagtt
tccgaaggctcagtagtgcttatgctagaagtggctggaagtgccccaaaagcagcacca
aagactgaaagtaaagcccctgctcagcaagccgctcagacatctgctcccgctcagaat
acgcctaaatcagcgcctgttcctcatcacccatcagcgggtgaacgtggtaaagcaggt
aaagtacatgcgtcgccttcagttcgccgtgttgcccgtgaattcggtgttgatttgacc
caagtgaaaggtacaggcccgaaaaaccgcgtccttaaagaagatgttcaatcgtatgtt
aaatatgaattgtctcgtcctaagatgactgctggttcttctgtcaataacggtggcggc
ggtttacaagtgcttgcgccacctaaagttgatttcagcaagttcggcgaagtggaagaa
attccgttaacccgtatccagaaaatctctggaccaaacttgcatcgtaactgggtcact
atcccacacgtaacacagtttgaagaagccgatatcacagatttagaagccttccgtaag
cagcaaaacgccgttgccgaaaagaaaaagcttggctttaaaataacgccattggttttc
atgatgaaagctgtagcagacgcgctcaaagcgtaccctgtgtttaactcttcactgtct
gagtctggcgaaagcttgatccagaagaagtatttccacgtgggtattgccgtagaaaca
ccgaacggtttggtagtgcctgttgtacgtgatgtagataagaaaggtatctacgatcta
tcaaaagaattgatggaaatcagtatcaaggcgcgtgacggaaaacttaaagccgctgac
atgcaaggcagttgtttcaccatttctagcttaggcggaattggcggaacagcatttaca
cctattgtaaatgcaccagatgtcgccatattaggtgtgtctaaaagtgaaatgaagccg
aaatggaacggtaaagacttcgagccaaggctaatgctgcctttatcattgtcttacgat
caccgagtcattgatggcgcagttgctgcacgcttcgctgttcacttgggcaaagtccta
ggtgacttgcgcgaaatgttactgtaa

DBGET integrated database retrieval system