KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1032Help
Entry
Glaag_1032        CDS       T01483                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Brite
KEGG Orthology (KO) [BR:gag00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Glaag_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Dicty_CAR
Motif
Other DBs
NCBI-ProteinID: AEE21993
UniProt: F4AR72
Position
1213662..1214930
Genome map
AA seq 422 aa AA seqDB search
MDILQTYGFTLIVVAALVGFLMAWGIGANDVANAMGTSVGSKALTIKQAILIAMVFEFAG
AYLAGGEVTSTIRKGILDSTFFIDSPELLVYGMISALLAAGIWLGFASYLGWPVSTTHSI
VGALVGFAAVGVSADAVEWSAVGGIVGSWVITPAISGFIAFLIFQSAQKLIFDTDKPFDN
ARRYVPFYMGLAGFVMSLVTIKKGLKHVGLHIEPADGYYIAIAIAILVGIVGKYAISRVQ
YDSKADKRTHFANVEKIFAILMIVTACCMAFAHGSNDVANAIGPLAAVVSIIHSDGEISN
KAGLVWWILPLGGLGIVAGLALFGHRVIATIGNGITHLTPSRGFAAELAAACTVVLASGT
GLPISTTQTLVGAVLGVGMARGIAAINLGVVRNIVVSWVVTLPAGAGLSILFFFVLKGIF
AP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatattttacaaacatacggcttcacacttattgtggtagctgctctagtcggtttc
ctcatggcatggggtattggtgcaaatgatgtagccaatgccatgggcacatctgttggc
tccaaggcgctaaccatcaaacaagcgatattgattgctatggtgtttgaatttgctggc
gcttacttagcggggggcgaggtaacctctaccatccgcaaaggtatattggactctacc
ttcttcattgatagccctgaattacttgtttacgggatgatatctgcattactcgcagcg
ggcatttggttaggctttgcgtcttatttgggctggccggtttctaccacacactctatt
gtcggtgcattggtcggctttgcagcagtaggcgtaagtgccgatgctgtagaatggagc
gcggtaggagggattgttggtagttgggttataacacctgcgatatcgggttttattgct
tttttgatattccaaagcgcacagaaattgatttttgataccgacaagccgtttgataac
gcgagacgttatgtgccattttatatgggccttgcgggtttcgttatgtcgttagtgacg
atcaaaaaagggttgaagcacgttggtttacatattgagccagccgatggttattacatc
gctattgccatcgcaatcttagtaggaattgtaggtaagtacgcaataagtcgtgtgcaa
tacgactcaaaagctgacaagcgtacccatttcgcaaatgttgaaaaaatattcgccatt
ttgatgattgtcaccgcgtgttgtatggcgtttgcgcatggttcgaatgacgtcgctaac
gccattgggccgttggctgcggttgttagtattatccatagtgacggtgaaatcagtaat
aaagcaggattagtatggtggatactacctttaggtggtttaggcatcgtggccggtttg
gcattatttggtcatcgcgtaatcgctaccattggtaacggcatcacccacttaacgcca
agccgaggctttgccgctgaactggctgcagcgtgtaccgtagtgttagcttctggtact
ggtttacctatctcgaccacgcaaactttggttggcgcggttttaggtgtaggaatggcc
cgtggtatcgctgcgattaacctaggagttgtacgaaacatcgttgtctcttgggtggtt
acactgccagcgggtgcagggttgtcgatattattcttctttgtgcttaaaggtattttt
gcaccataa

DBGET integrated database retrieval system