KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1316Help
Entry
Glaag_1316        CDS       T01483                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00620  Pyruvate metabolism
gag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Glaag_1316
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gag02000]
    Glaag_1316
Enzymes [BR:gag01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Glaag_1316
Transporters [BR:gag02000]
 Other transporters
  Primary active transporters [TC:3]
   Glaag_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N PTS_EIIA_1 PRP4 GCV_H Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AEE22277
UniProt: F4ATM8
Position
1530710..1532500
Genome map
AA seq 596 aa AA seqDB search
MSKPLAITDVVLRDAHQSLLATRMRIEDMLPIAAKLDQVGYWSLETWGGATFDSCIRYLG
EDPWERIRRLKQAMPNTKQQMLLRGQNLLGYRHYADDVVEKFVERAHTSGVDVFRIFDAM
NDIRNLKTAVGAAIKVGAHAQGTISYTVSPVHSLSLWLDMAKQLEDLGVHSICIKDMAGL
LKPYVCEELITRLKETVSVPIAMQCHATTGLSTATYQKAIDAGIDILDTSISSMSMTYGH
SATETMVAIVEDTPRDTGLDLPLLAEIAAYFRDVRKKYAKFEGSLKGVDARILLAQVPGG
MLTNMESQLVEQGAQDKLDEVLKEIPRVREDLGFIPLVTPTSQIVGTQSVLNVLTGERYK
SITKETAGVLKGEYGATAAPVNSELQARVLDGKEAITCRPADLIDDELATLENDLLTQAK
EQGITLADNAIDDVLTYALFPQIGLKFLKNRNNPDAFEPVPTGEEATSLPAQNSGAAKAT
ESYSVRVDGKVYAVEVAPGGALTDIQVADNGTSAQTAAPAPVSSAGSEEVAAPLAGNVFK
LLVRPGDTISEGDVIVIMEAMKMETEIRSTASGTILDILVKEGDAVQSGQTMLTLG
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaccattagccatcacggacgtagtgctgcgtgacgcacaccaatcattactt
gcgacacgtatgcgcattgaagatatgctgcctattgcagccaagctcgatcaagttgga
tactggtcactagaaacttggggtggtgcgacgtttgactcctgtatacgttatttaggt
gaagatccttgggagcgtattcgtcgactaaagcaagcgatgcctaatactaagcagcaa
atgctcttgcgcggacaaaacttgttaggttaccgccactatgctgacgacgtcgttgaa
aagtttgtagagcgcgcgcacacaagcggagttgatgtatttcgcatctttgatgcgatg
aatgacatccgtaacttaaaaacagctgttggggccgcgattaaagtaggcgcacatgcc
caaggcactatttcatacacagttagcccagttcactctttgtctttgtggctagatatg
gcaaagcagttagaagatttaggcgtacattcaatttgcattaaggacatggcgggtttg
cttaaaccttatgtatgtgaagagctgataacgcgtcttaaagagaccgtgagcgtgcca
atcgctatgcagtgtcatgctactaccggtctaagcactgcaacctatcagaaagcgatt
gacgcaggaatcgatattcttgatacgtctatttcgtccatgagtatgacctacggtcat
agtgctacagaaaccatggtggcaattgttgaagatacacccagagacactggactcgat
ttacctttgttggctgaaattgccgcttactttagagacgtacgtaaaaaatatgcgaag
tttgaaggcagcttaaaaggagttgatgcgcgtattttactggcgcaagtaccagggggc
atgttgaccaacatggaatctcagcttgtcgagcaaggagctcaagataaactagacgaa
gtactgaaagaaatccctagagtacgagaagatcttggttttattcctcttgtgaccccc
acatcacaaattgttggtactcagtcagtacttaacgttttaactggcgagcgttacaag
agtatcactaaagaaaccgcaggggtgttaaaaggtgaatacggggcgaccgcagcaccc
gttaacagtgagttacaagcgcgggtactggatggaaaagaagccattacgtgtcgcccc
gccgatttgatagacgatgaattagccaccttagaaaacgatttgttaactcaggctaaa
gagcaaggtattacattggcagacaacgcaattgatgatgtgttgacctacgcactgttc
ccgcaaatcggtttaaagtttcttaaaaatcgcaacaatccagatgcatttgaacctgta
cctacaggtgaagaagcaactagcttgcctgcacaaaactcaggtgctgctaaagcaaca
gaatcttattctgtgcgtgttgatggcaaagtatacgcagtagaggttgcaccaggtggc
gcgttaactgacatacaagttgcagataatggcacaagtgcacaaactgcagctcctgct
cctgtttcatctgctggcagtgaagaggtagcagccccgcttgctgggaatgtgtttaaa
ttacttgttcgcccaggtgatacgatcagtgaaggtgacgtcattgtcattatggaagcc
atgaaaatggagacagagatacgctcaacggccagcggtactatccttgatatcttggtc
aaggaaggcgatgcggtgcagtctgggcaaacgatgttgacgttggggtaa

DBGET integrated database retrieval system