KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1531Help
Entry
Glaag_1531        CDS       T01483                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00970  Aminoacyl-tRNA biosynthesis
gag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gag00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Glaag_1531
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gag03029]
    Glaag_1531
Enzymes [BR:gag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Glaag_1531
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Glaag_1531
Mitochondrial biogenesis [BR:gag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Glaag_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEE22487
UniProt: F4AJK1
Position
1767415..1768761
Genome map
AA seq 448 aa AA seqDB search
MDMALLSQDVSTHVALIKDKQISAQELAELQYRYIQRVNPKINAFLQTALPKCAPQETRT
GSVFQGICIGVKDNIDVKGFATTAGMATRIGRQAKQDAFVINRLRQTGAQFIGKLNMHEG
ALGATNQNEHFGDCHNPHKHGYTPGGSSGGSAAAVASGMVGLSLGTDTMGSVRIPAAYCG
IFGFKPSRGAVSNHGSVTCSRVMDSIGPMARSAKDLTLAISVMKAFDESCAASIDFKAID
CFTASDNKVLLVPENLEGLGVSSDVAADFSANLSAFTDLGYTLEYFDFSDYDFAAARRAG
LLLCEADMRVEHQEDWLNQPQKFSEYMRGMLSYIERKTPMDIMQSERVLDNAKIFARQLF
KQGCAILMPTVLQRAFSFAQPVPANQADLTSFANQAGLPAVSLPMLSDNILPAGMQIVGP
LGSDNQLLDLAERWQEHTQFRYILPSLD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggatatggcactactcagtcaggatgtgagcacccatgtcgccctgatcaaagataag
caaatttctgcgcaagaattggcagagctgcaataccgctatattcaacgggtcaatcct
aaaattaatgcgtttttacaaactgctttacctaaatgtgcacctcaagagacgcgcaca
ggttcggtgtttcaaggcatttgtataggcgttaaagataatattgatgtgaaggggttt
gcgaccacagccggcatggcgacccgtatcgggcgacaagcgaagcaagacgcgtttgta
attaatcgtcttcgtcaaaccggggcccagtttataggcaaattgaatatgcatgagggc
gcccttggtgccaccaaccaaaatgaacattttggtgactgccacaacccacacaaacac
ggttatacgccgggcggttcttctggcggctcggccgcagcggtggcctcaggtatggtt
ggcttatcactaggtacagatactatggggtcggtgcgtattcctgcggcctattgcggt
atctttggttttaagccaagtcgcggcgcggtgagcaatcatggctcagtaacgtgtagc
agggtgatggatagtatcgggcctatggcgcgctctgcaaaagatttaacactggccatc
agtgtgatgaaagcatttgacgaaagttgtgctgcctctatcgattttaaggcaattgat
tgctttactgcttctgacaataaagtactactggtacccgaaaacctcgaagggttaggt
gtatcctctgatgtcgctgctgacttttctgccaatttaagtgcatttactgacttaggg
tatactcttgagtatttcgatttttctgattatgacttcgctgcagcccgaagggctggc
ctactgctttgtgaagccgacatgcgcgttgagcatcaagaagattggctaaaccagccg
caaaaattctcagaatatatgcgcggcatgttgtcatatatagaacgaaaaacccccatg
gacataatgcaatctgagcgagtgctagataatgcgaaaattttcgcccggcaactgttc
aagcaaggctgcgccatactgatgccaacggttttgcaacgcgcattttcgtttgcacag
ccagtaccggcgaatcaagctgacttaaccagttttgctaaccaagctggtttgccagca
gtgtctttaccaatgctaagtgacaatatactgccagctgggatgcaaattgttgggcca
ctgggcagcgacaatcaactgttagacttagctgagcgttggcaagagcacacccagttt
cgttatattttgccgagccttgactaa

DBGET integrated database retrieval system