KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1784Help
Entry
Glaag_1784        CDS       T01483                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00020  Citrate cycle (TCA cycle)
gag00640  Propanoate metabolism
gag00660  C5-Branched dibasic acid metabolism
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01120  Microbial metabolism in diverse environments
gag01130  Biosynthesis of antibiotics
gag01200  Carbon metabolism
Module
gag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Glaag_1784
   00640 Propanoate metabolism
    Glaag_1784
   00660 C5-Branched dibasic acid metabolism
    Glaag_1784
Enzymes [BR:gag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Glaag_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AEE22734
UniProt: F4AM54
Position
2078283..2079452
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSEGYAAETPQAAVEAADRIGGTEWVVKCQVHAGGRGKAGGV
KLVKNKDEIKAFAQKWLGQNLVTYQTDEAGQPVSKILVESCTDIAQELYLGAVVDRASRR
VVFMASTEGGVEIETVAEETPEKILKAEIDPLVGAQPYQAREIAFKLGLKGVQIKQFTQI
FMGLAKLFEEKDIALIEVNPLVIKDDGNLHCLDAKVAMDSNAAYRQPKLQEMHDPSQEDA
REAQAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGSPANFLDVGGGATKERVAE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVTIPVVVRLEGTNAELGREV
LANSGLDIIAASSLTDAAKQVVKAAGGAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatatcagggtaaacaattattcgctgaatacggtttacctgtatct
gaaggatatgctgcggaaactccgcaggctgcagttgaagcagcagatcgtattggcggt
actgaatgggttgtgaaatgtcaggttcacgctggtggtcgcggtaaagcaggcggtgtt
aagcttgttaagaacaaagatgagatcaaggcatttgcacaaaaatggcttggtcaaaac
ttagtgacttatcagacagatgaagctgggcaaccagtaagcaaaatcttggttgaaagc
tgtacagatattgctcaagaattgtacctaggtgcagttgttgatcgtgcttctcgtcgc
gttgttttcatggcatctaccgaaggtggtgttgaaattgaaacagttgcagaagagaca
cctgaaaaaattcttaaggctgagatcgaccctctagtaggtgctcaaccttaccaagca
cgtgaaatcgcgttcaagcttggccttaaaggcgttcaaatcaaacaattcactcaaatc
ttcatgggtttggcgaaattgttcgaagaaaaagacattgcacttatcgaagttaacccg
cttgttattaaagatgacggtaaccttcattgtcttgacgctaaagttgccatggacagc
aacgctgcctaccgtcaacctaagcttcaagaaatgcacgatccttcacaggaagatgca
cgtgaagcacaagcggctaagtgggagcttaactacgtagcacttgatggtaacatcggt
tgcatggttaacggtgcaggcctagcaatgggtactatggatatcgttaacttgcacggt
ggttcacccgctaacttcctagacgttggtggcggtgcaactaaagagcgtgttgctgaa
gcattcaaaattatcctatctgactcaaatgttgccgctgtattggtaaacatttttggt
ggtatcgtacgttgtgacatgatcgctgaaggtattatcggagcggttaaagaagtcggt
gtaactatccctgttgttgtacgtttagaaggtaccaacgcagagcttggccgtgaagta
ttggctaactcaggtttagatatcatcgctgcttctagtttaacggatgctgcaaaacaa
gttgttaaagctgccggaggtgctgcatga

DBGET integrated database retrieval system