KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1899Help
Entry
Glaag_1899        CDS       T01483                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00620  Pyruvate metabolism
gag00630  Glyoxylate and dicarboxylate metabolism
gag01100  Metabolic pathways
gag01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Glaag_1899
   00630 Glyoxylate and dicarboxylate metabolism
    Glaag_1899
Enzymes [BR:gag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     Glaag_1899
    1.2.1.22  lactaldehyde dehydrogenase
     Glaag_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC OmdA
Motif
Other DBs
NCBI-ProteinID: AEE22844
UniProt: F4ANQ4
Position
complement(2212715..2214178)
Genome map
AA seq 487 aa AA seqDB search
MTVQELDFKNNVNFIGGEYVSSKADGKIEILSPATGKVIGEIPKGCKEDAEQALDVAQAA
QKSWAKLTARTRQNILRTFANKIRENKHILAPMLVSEQGKLLSVAEMEVDVTATFIDYAC
DNALTIEGDILPSDNQDEKIYIHKVPRGVVVGITAWNFPLALAGRKIGPALITGNTMVLK
PTQETPLATTELGRIAKEAGVPDGVFNVINGTGSVVGQALCESPITKMITMTGSTVAGKQ
IYKTSAEYMTPVMLELGGKAPMVVMNDADLDKAAEDALWGRFANCGQVCTCVERLYLHED
IYDQFMSKFLPLVQGLKVGDPMASDTQMGPKCNQREIDNIEHIVQEAIKQGATVATGGKT
VSIDGFEGGCWYEPTVLVDVKQDNIVVHEETFGPILPIVKVSSMEQAIEYCNDSIYGLSA
YVHTQSFTNINQAISDLEVGEVYINRGMGEQHQGFHNGWKQSGFGGEDGKFGLEQYLEKK
TVYINEA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacggttcaagaactagattttaaaaacaacgtaaatttcattggtggtgaatatgtt
tcatctaaagctgatggcaagatagaaatacttagtcctgctacaggaaaagtcattggt
gaaataccaaaaggctgtaaagaagatgccgaacaagcactcgacgttgcacaggcagcg
caaaaatcatgggccaagttaactgcccgtacccgacaaaacattttgcgtacatttgca
aataagatccgtgaaaacaagcacatcctagcgcctatgctcgtctctgaacaaggtaaa
ttgttgtcagtcgccgaaatggaagtggacgtaaccgccacctttattgattatgcttgc
gacaatgcactaaccatcgaaggtgacatactcccttctgataaccaagacgaaaaaatc
tacattcacaaggtgcctagaggcgttgtggtgggtattaccgcatggaacttcccactt
gctttggcaggtcgtaagattggccctgcgcttattaccggtaacaccatggtattaaag
cctacgcaagaaacaccgcttgccaccacagagcttgggcgtattgccaaagaagcaggc
gtaccggacggcgtattcaacgtgatcaacggtactgggtctgttgtaggccaggcactg
tgtgaaagccccatcactaagatgatcaccatgacgggctctaccgttgccggtaaacaa
atctataaaaccagtgccgagtatatgaccccagtcatgctcgaattgggtggcaaagca
cctatggttgtcatgaacgatgcagatttagacaaagccgcagaagacgctctttggggc
cgattcgccaactgtggtcaggtgtgtacctgcgtagaacgtctttacttgcatgaagac
atttatgaccagtttatgagtaagttcctccccttagtacaaggtttaaaagtaggcgac
cctatggcgagtgatacgcaaatgggcccgaaatgcaaccagcgtgaaatcgacaacatc
gagcacattgtgcaagaagcaattaaacaaggggcgaccgtcgcgacaggtggaaaaacc
gtatccattgatggctttgagggcggctgttggtatgagccaaccgttttagttgatgta
aaacaagacaacattgttgtgcatgaagaaacgttcggcccaattctaccgatagtgaaa
gtcagtagcatggagcaggcaatcgagtattgtaacgacagtatctatggtctcagtgct
tatgttcacacccaaagctttaccaatatcaatcaagcgatcagtgatttagaagtcggt
gaagtgtatatcaatcgcggtatgggcgaacaacaccaagggttccataacggttggaaa
caaagtggctttggtggtgaagacggtaaattcggacttgaacagtatcttgaaaagaaa
acggtttacattaacgaggcctaa

DBGET integrated database retrieval system