KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2289Help
Entry
Glaag_2289        CDS       T01483                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00072  Synthesis and degradation of ketone bodies
gag00650  Butanoate metabolism
gag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Glaag_2289
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Glaag_2289
Enzymes [BR:gag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Glaag_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2 DUF1776 3HCDH_N Sacchrp_dh_NADP TrkA_N RmlD_sub_bind ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AEE23234
UniProt: F4AS32
Position
2669172..2669957
Genome map
AA seq 261 aa AA seqDB search
MSNSTHSKNKTILITGGASGIGLGIAQQLGASGHKIIVADMNMDAAEHAAAELGAQGISA
RALLLDVTNPQQVASLPDTLLPDTVDVLINNAGIQHVSKLEDFPADKWQQLINIMLVAPA
MLTQALLPAMRVKNYGRIINIGSVHSVIASPFKSAYVAAKHGLLGFSKTIALETGDCDVT
INTLCPAYVKTPLVEKQIAAQAKEHGMSEEDVINKIMLEPMPKKSFIDIDELASSAAFLM
DNSARNITGQTIVIDGGWTAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattcaacccattctaaaaataaaaccatccttatcacaggtggtgccagcggt
atcggcttagggatcgcccaacaattaggggcaagtggccacaagattatcgttgcagat
atgaatatggacgctgcagaacatgccgcagctgaactaggggcacaaggcataagtgct
cgcgcgctattgcttgatgtaacgaatcctcaacaggtagcaagcctgccagataccttg
ctacccgacacagtcgatgtactcattaacaatgcgggtatacaacacgtgtctaaactc
gaagactttccggcggataaatggcaacagctaatcaatatcatgctggtggcacccgca
atgttgacccaagctttattgcctgcaatgcgggtaaagaactatggccgtattattaat
attggctcggtgcactcggtcattgcctcaccatttaaatcggcctacgtggccgcgaaa
catggcttattgggcttttctaagactatcgcactagaaaccggagattgcgacgttacg
attaataccctgtgcccagcctatgtaaaaacccccttagttgagaaacagatagccgca
caagccaaagagcatggtatgagtgaagaagacgtaatcaataaaataatgcttgaaccc
atgccgaagaaatcattcatcgacatagacgaactcgccagtagcgctgcatttttaatg
gacaacagcgcccgtaatattaccggacaaactatcgttatcgacggaggctggacagcg
cgttaa

DBGET integrated database retrieval system