KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2909Help
Entry
Glaag_2909        CDS       T01483                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00260  Glycine, serine and threonine metabolism
gag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01130  Biosynthesis of antibiotics
gag01230  Biosynthesis of amino acids
Module
gag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Glaag_2909
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Glaag_2909
Enzymes [BR:gag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Glaag_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEE23846
UniProt: F4AM83
Position
3378885..3380072
Genome map
AA seq 395 aa AA seqDB search
MNHLESKFGQFGGMYVPELLIPALDQLEQAFIDAQNDPEFQKEFIELLTDYAGRPTAMTL
SRNLVSNPNVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKTEVIAETGAGQHGVATAL
ACALLGLKARIYMGAKDVERQAPNVFRMRLMGAEVIPVNAGSGTLKDAVNEAMRDWSATY
DKAHYLLGTAAGPHPFPTIVREFHRMIGEETRAQIMAKEGRLPDAVVACVGGGSNAIGMF
ADFIDEPSVQLIGVEPAGKGLHTAEHGAAIGKGTTGILHGAYSYIMQDEDGQIEESYSVS
AGLDYPAVGPQHAHLSDIGRATYTAVTDDEALYAFQLLSRKEGIIPALESSHALAHALNM
ADEAEDGTIIVVNLSGRGDKDLAHVHSILGGETNE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatttagagagcaaattcggacagtttggtggcatgtatgtgccagaactgctt
attcccgcgcttgatcaattagaacaagcattcattgatgcgcaaaacgatcctgaattt
caaaaagaattcattgaattgcttaccgactacgcagggcgtcccactgccatgaccttg
tcgcgtaatttggtatcaaaccccaacgtcaaactgtacttaaaacgtgaagacttactt
cacggcggcgctcacaaaaccaatcaagtattgggtcaggcactactgactaagcgtatg
ggtaaaaccgaagttatcgctgaaacaggcgcagggcaacacggcgttgccacggcatta
gcctgtgcactgttaggcctaaaagcacgtatttatatgggggcgaaagacgttgaacgt
caagcaccgaacgtatttagaatgcgtttaatgggcgctgaagtcatacccgtaaatgcg
ggctcaggcaccctaaaagatgccgttaacgaagccatgcgtgactggtctgcgacttat
gataaagcccattatttgcttggtactgcagctgggcctcacccattcccaacgatagta
cgtgaattccaccgtatgataggcgaagaaactcgcgcgcaaattatggccaaagaaggc
cgcttacctgatgcggtagtcgcctgcgtgggtggcggttcaaatgcgattggtatgttt
gccgactttatcgatgagccaagcgtgcagctaattggagtagagcctgcaggtaaaggc
ttgcacaccgccgaacatggcgctgcaattggtaaaggcacaaccggtatcttacatggt
gcctacagctatattatgcaagatgaagacggccaaattgaagagtcttactctgtatcc
gctgggcttgattacccagctgttggccctcagcatgcccatttgagcgatattggccgt
gctacttataccgcagtcacagatgatgaagccttgtatgcatttcagttgctatcacgc
aaagaagggattattccagcgcttgaatcatctcatgccctggcccatgccttaaacatg
gccgatgaagccgaagacggcacaattatcgtagtcaatttatccggtcgtggtgacaaa
gatttagcccacgtacacagcattttgggaggcgaaaccaatgagtaa

DBGET integrated database retrieval system