KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3248Help
Entry
Glaag_3248        CDS       T01483                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00270  Cysteine and methionine metabolism
gag00480  Glutathione metabolism
gag01100  Metabolic pathways
Module
gag_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Glaag_3248
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Glaag_3248
Enzymes [BR:gag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Glaag_3248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD RET_CLD1 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AEE24182
UniProt: F4AQG2
Position
complement(3785800..3786762)
Genome map
AA seq 320 aa AA seqDB search
MTIKLGVVMDPIGSINIKKDTSFAMLLGAQARGYEIFYIEMGDLYLNNGKPMAQMRRLTV
QEDANNWFELQAEENRGLGELDVILMRKDPPFDSEFLYATQMFELAEQTGTLVVNKAQSL
RDFNEKLFTSWFPELIPDTLVTRSAKLIREFHATHQDMICKPLDGMGGTSIFRVKPDGNN
LGVIIETLTKLGTQYAMFQRYLPEIKDGDKRILIVDGQVVPYALARLPQKGETRGNLAAG
GKGRAQPLSESDLKLANTIAPLLVEKGLIFVGLDVIGDRITEINVTSPTCVREIQAAYPV
DIVAMLFDAIEKRLSARDNL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgaccattaaacttggcgtagtaatggatcctattggatcgatcaatatcaaaaaagac
actagttttgccatgctattaggggcacaagcgcgcggctacgaaatattttatatcgaa
atgggcgacctgtacttaaacaatggcaagcctatggcccaaatgcgccgcttaactgtg
caggaagatgccaataattggtttgagctgcaagcagaagagaatcgcggactaggtgag
cttgacgtcatattaatgcgtaaagatcccccttttgacagcgagttcttatatgccact
caaatgtttgaattggcagagcaaacaggcactttagttgtgaacaaggcgcagagctta
cgtgattttaacgagaagctatttacctcttggttccctgaattaattcccgataccttg
gtaacacgcagcgccaagctaatccgtgagttccatgcaacccaccaagacatgatttgt
aagccgctggatggtatgggcggcacgtctattttccgtgtaaagcctgatggtaataac
cttggcgttatcatcgagaccttaacaaaactgggtactcaatatgccatgttccagcgt
tacctgcctgaaataaaagacggtgataagcgtattttgattgttgatggtcaagttgtt
ccttatgcgttagcgcgtttaccgcaaaaaggcgaaacgcggggtaatttggcagcaggt
ggcaagggccgcgcacaacctttgtctgaaagtgacctaaagctagctaataccattgcc
ccgttattggtagaaaaaggattgatttttgtaggcttagacgtgataggtgatcgtatt
actgaaataaacgttaccagcccaacgtgcgttcgagaaattcaagcggcctacccagtt
gatattgtagctatgctatttgatgctatcgagaagcgcttaagtgcgcgagacaacctt
taa

DBGET integrated database retrieval system