KEGG   Geoglobus ahangari: GAH_00300Help
Entry
GAH_00300         CDS       T03939                                 

Definition
(GenBank) geranylgeranyl reductase family
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
gah  Geoglobus ahangari
Pathway
gah00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GAH_00300
Enzymes [BR:gah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     GAH_00300
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     GAH_00300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_oxidored FAD_binding_2 DAO HI0933_like Trp_halogenase NAD_binding_8 Pyr_redox_2 Lycopene_cycl GIDA Thi4 Pyr_redox AlaDh_PNT_C Pyr_redox_3 3HCDH_N Sec34
Motif
Other DBs
NCBI-ProteinID: AKG92346
UniProt: A0A0F7DC74
Position
256735..257907
Genome map
AA seq 390 aa AA seqDB search
MTDYDVVVVGAGPAGSIAAKTAAEKGLDVLLIEKRQEIGVPVRCAEGVSREGLESFVKPD
SRWIASEIESAEIISPSNHKVVLSAESAGNEVGYVLERKIFDRYLARLASKAGADVLTKT
AAVSFRREDGIVRLGIRSMGEFEEVMTKLVIGADGVESRVAKWAGIDTTLKLNEIESCVQ
YLMTNIDFEDDKTYFWVGRKYAPGGYIWLFPKGKDAANVGIGVMPSLAERNAKWYLDRFV
KENFPEGEIVEVVVGGVPVKGAIDSAVADNVMLAGDAARHTDPITGGGIINAMKAGYYAG
LTAYESVEAKDYTAGFLKRYDERWKGDFGENLVRNKKLQEKMVKLDDATLDKLTESLEGV
PIEEMSVKRLALELFKKHPKLLWDLREFLK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacagactacgacgtcgttgttgttggagccgggcctgctggcagcatcgccgcgaaa
acggctgctgaaaagggtcttgacgtcctgctgatcgagaagaggcaggagatcggagtt
ccggtcaggtgtgctgaaggtgttagcagggagggtcttgagagcttcgtgaagcctgac
agcaggtggatcgccagcgagattgagagtgctgagataatctccccctcaaaccacaag
gtcgttctctctgcagagagcgccgggaatgaggttgggtacgttctcgagaggaagata
ttcgacagatacctcgcaaggctcgcaagcaaggccggtgcggatgttctcacaaaaact
gctgcagtgtcgttcaggagagaggacgggattgtaaggctcggaataaggagcatgggc
gagttcgaggaggtaatgacgaagctggtgatcggggctgatggggttgagagcagggtt
gccaagtgggcgggaatagacacaactctaaagctcaacgagatcgagagctgcgtgcag
tacttgatgacgaacatagacttcgaggacgacaagacctacttctgggtgggcaggaag
tacgcaccgggcggctacatctggctcttccccaagggaaaggatgctgcgaatgtgggc
ataggtgtgatgccgagcctcgccgagaggaacgcgaaatggtacctcgacagattcgtg
aaggagaacttccctgagggagagatcgtagaggttgtggtcggcggtgtccctgtgaag
ggcgcgatagacagtgcggttgcagacaacgtgatgctcgcaggagatgcggcaaggcac
actgacccgataactggtggagggataataaacgcgatgaaagccggatactatgcagga
ctgaccgcatacgagtcggttgaggcgaaagactacaccgcaggcttcctgaagaggtac
gacgagcgttggaagggagacttcggtgagaacctcgtcaggaacaagaagctgcaggag
aagatggtgaagctcgatgatgctacgctcgacaagctgaccgagagcttggagggtgtg
cccatagaggagatgagcgtaaagaggctcgcgctcgagctgttcaagaagcacccgaag
cttctgtgggatctgagggagtttctgaagtaa

DBGET integrated database retrieval system