KEGG   Geoglobus ahangari: GAH_00737Help
Entry
GAH_00737         CDS       T03939                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
gah  Geoglobus ahangari
Pathway
gah00630  Glyoxylate and dicarboxylate metabolism
gah01100  Metabolic pathways
gah01110  Biosynthesis of secondary metabolites
gah01120  Microbial metabolism in diverse environments
gah01130  Biosynthesis of antibiotics
gah01200  Carbon metabolism
Module
gah_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:gah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GAH_00737
Enzymes [BR:gah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     GAH_00737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKG91928
UniProt: A0A0F7IFL3
Position
complement(628339..629673)
Genome map
AA seq 444 aa AA seqDB search
MSEQFGEIYDYYVDKGYQPNFKRDIVAVFRITPAEGYTIEECAGAVAAESSTGTWTTLYP
WYERERWEDLSAKAYEFSQSEDGSWIVKIAYPLHAFEEANLPALLASIAGNVFGMRRVAG
LRLEDLYFPEKLIREFGGPSKGIDGVRKMLEIKDRPIYGVVPKPKVGYSAEEFERLAYDL
LSSGADFVKDDENLASPWYNRFEERAETVSRIIERVESETGEKKTWFANITADVREMERR
LEILAELGLKHAMVDVVITGWGALEYIRDLAEDYGLAIHGHRAMHAAFTRNRSHGISMFV
LAKLYRLIGIDQLHVGTAGAGKLEGGKWEVVQNARILREKEYVPDEGDEIHLPQKFYGIK
PAFPTSSGGLHPGNLPLVFEALGTDIVVQLGGGTVGHPDGPAAGAKAVRQAIDAIMSGVP
LEEYAKSHRELARALEKWGTVTPI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcagtttggagagatttacgactactacgtggacaagggctaccagcccaac
ttcaagagggacatcgtggctgttttcaggataactcccgctgagggttacacaatcgag
gagtgtgccggggctgtagctgctgagagctcaacaggcacgtggacgacactctaccca
tggtacgagagggagaggtgggaggatctctcagccaaggcatacgagttctcccagagc
gaggatggttcctggattgtgaagatcgcctacccactccacgcgtttgaggaggctaac
ctgccggctctgctcgcgtcaatagccggaaacgtcttcgggatgaggagggtcgctggg
ctcaggctcgaggacctctacttcccggagaagctgataagggagttcggagggccgtca
aagggaatagacggagtaaggaagatgctcgaaataaaggacaggccgatctacggtgtc
gtgcccaaacccaaggttggatactcggccgaggagttcgagaggctcgcgtatgacttg
ctgtcgtctggagcggacttcgtcaaggacgatgagaatctggcgagcccgtggtacaat
cgctttgaggagagggctgagacggtcagcaggataatagagagggtcgagagcgagacg
ggcgagaagaagacctggtttgcgaacatcacggctgacgtgagagagatggagaggagg
ctcgagattctcgcggagctcgggctcaagcatgcgatggttgacgtcgtgataacggga
tggggagcactcgagtacataagggatctcgcagaggattacgggctcgcaattcacgga
cacagggcaatgcacgctgcgttcacgaggaacaggagccacgggatcagcatgttcgtc
ctcgccaagctctacagactcatagggatagaccagctccacgttggcacggcaggagca
ggaaagctggaaggcggaaagtgggaggtcgtgcagaacgcgaggattctgagggagaag
gagtacgtgccagatgagggagatgagatacacctgccccagaagttctacgggataaag
cccgctttcccgacgagctccggtggtctgcacccgggaaacctcccgctggtcttcgag
gccctcggaacggacatagtggtgcagctcggaggagggaccgtgggtcacccggatggc
ccggcagctggagccaaggctgtcaggcaggcgatagatgcaataatgtccggagttccg
cttgaagagtacgccaagtcccacagggagcttgcgagagccctcgagaagtggggaacc
gttacgcccatctga

DBGET integrated database retrieval system