KEGG   Geoglobus ahangari: GAH_00876Help
Entry
GAH_00876         CDS       T03939                                 

Definition
(GenBank) putative sugar phosphatases of the HAD superfamily
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
gah  Geoglobus ahangari
Pathway
gah00627  Aminobenzoate degradation
gah01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gah00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GAH_00876
Enzymes [BR:gah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     GAH_00876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Acid_phosphat_B Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AKG91796
UniProt: A0A0F7DBW4
Position
740579..741379
Genome map
AA seq 266 aa AA seqDB search
MEIDGLILDIDGVISRGRKPIERAIEGYRMLKDAGIKVVFVSNNSTRSRRIMFERFASFG
IDAEEEDLIIATHATAVYIAREHGKARIYTTGEPGLQEELQNLGHELVDYREAEFLVVGS
NRGINFEIFTKALRLALNENIRYVAVNPDKVFPAEDGPIPGTGLIIGALYWMTGRMPDAI
VGKPSKIIMEQAIERLGLDRDRVAIVGDQIDVDVLAGKNAGIKTILVLSGVTDESNYRKK
VEEVGVEPDYVFRDLYEVAQRLTSSK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgacggtttgattctcgacatagacggcgtgatatcgaggggcaggaagccc
atagagagggccatagagggctacaggatgctgaaggatgcggggataaaggtcgtcttc
gtctccaacaactcgacgaggagcaggaggataatgttcgagaggttcgcgagcttcggc
atagatgctgaggaagaggacctgataatcgccacccacgcaaccgccgtttacatcgcg
agagaacacgggaaggccagaatatacacaaccggggagccggggcttcaggaagagctg
cagaaccttggacacgagctcgttgattacagagaggcggagttcctcgttgttgggtca
aacaggggaataaacttcgagatcttcaccaaagcactaaggctcgcccttaacgagaac
atcaggtacgttgcagtcaacccggacaaggtttttccggctgaggacgggccgatcccc
ggaacagggctgataatcggcgctctctactggatgacgggcaggatgccagatgctata
gtcgggaagccatcgaagatcataatggagcaggccatagagaggctcgggctggacagg
gatagggtggccatagttggggatcagatagacgttgacgtgctcgcgggcaagaatgcg
gggataaagacgatcctcgtcctctcgggagttacggacgagtcgaactacaggaaaaag
gtagaggaggtaggagtggagccggattacgtcttcagagacctgtacgaggtggctcag
aggctgacgtcctcgaagtag

DBGET integrated database retrieval system