KEGG   Granulosicoccus antarcticus: IMCC3135_13075Help
Entry
IMCC3135_13075    CDS       T04938                                 

Gene name
amiD_1
Definition
(GenBank) Putative amidase AmiD
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gai  Granulosicoccus antarcticus
Pathway
gai00970  Aminoacyl-tRNA biosynthesis
gai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gai00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IMCC3135_13075 (amiD_1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gai03029]
    IMCC3135_13075 (amiD_1)
Enzymes [BR:gai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     IMCC3135_13075 (amiD_1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     IMCC3135_13075 (amiD_1)
Mitochondrial biogenesis [BR:gai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    IMCC3135_13075 (amiD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ASJ72703
UniProt: A0A2Z2NNA1
Position
complement(2978738..2980006)
Genome map
AA seq 422 aa AA seqDB search
MTSSYPWTPDSAPIRVADLQARLDSDDPALRHVFTEIFHDPIAGQSPINNPLNGALVSVK
ELFDVKGHVTRAGTRFMAEDAPAVADALPIQRLRAAGAVMLGTTNMTELAYSGLGLNPHN
GTPENAIHAGCIPGGSTSGGAISVARGVADIAVGTDTGGSLRIPAAFNGIVGFKPTQATV
SRQGCKSLSQTLDSIGPMAASVETCSQAYQVMRDDSATTEREIDPVFIIPDNYGMDDLEP
EVAAAFTHAVLRLRDAGHDVRTQSLASLERLKSLAVWQIAAVEAYAEYHEALQSYPDQFD
PRVSSRIARAQTLSALEYRTTLNARNDLIRQYQAEMMGKVLLMPTVPILPPSMSVFDNDD
TYARLNVQVLRNPSIANVMDCCSISLPVIHEGNATGLMLTAQAFSDQALLQLAALCEALL
EA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatcctatccatggacacccgatagcgcccccatccgggtcgcagatctgcag
gccaggctcgacagtgatgaccccgctctgaggcatgtgtttaccgaaatctttcacgac
ccgatcgccggacaatcacccatcaacaaccccttgaatggggctttggtatcggtcaag
gaactgttcgatgtcaagggccacgtgacccgcgccggcacccgtttcatggctgaggat
gcacctgccgtagccgatgctctgcccatccagcgtttgcgagcagcgggtgcggttatg
ctcgggacgaccaatatgactgagcttgcctactccggtctgggtttgaatccccataac
ggaacgccggagaatgccattcatgccggctgcatcccaggtggctccacctcgggtggc
gcgatctcagtcgcccgaggtgtcgccgatattgccgtcggcaccgatactggtggttct
ctgcgtattcctgcagcattcaatggcatcgtggggttcaaacccacccaggccactgtg
tctcgccagggctgcaagtcactgtcgcagactttggacagcattggacccatggcagcc
agcgtggagacctgcagccaggcctaccaggttatgcgcgacgactcagccaccaccgaa
agagagattgatccggtattcatcatccctgacaactatggcatggacgatctggaacct
gaagttgcggcagcctttacccatgccgtattacgtctgcgcgatgcgggacatgacgta
cgtacacagtctctggccagccttgaacgcctgaaatcactggctgtctggcagattgca
gctgtcgaggcttacgcggaataccatgaagcccttcaatcatacccggatcagtttgac
ccgcgagtatcgagtcgcattgctcgtgcgcaaacactcagcgcgctcgaataccgcaca
actctgaatgcgcgcaatgatctgatccgtcaatatcaggcagaaatgatgggcaaggtt
ctactcatgccaaccgtccccattttgccgccctcaatgtccgtattcgacaacgatgac
acttacgctcgattgaacgtgcaagtcttgcgtaatcccagcattgccaacgtcatggat
tgttgcagcatttccctacccgtcattcacgaaggcaatgctaccggcttgatgctgact
gcccaggctttttcagatcaggccttactacaactggcagcactttgcgaagcattgctg
gaagcctga

DBGET integrated database retrieval system