KEGG   Granulosicoccus antarcticus: IMCC3135_17450Help
Entry
IMCC3135_17450    CDS       T04938                                 

Gene name
scoB
Definition
(GenBank) putative succinyl-CoA:3-ketoacid coenzyme A transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
gai  Granulosicoccus antarcticus
Pathway
gai00072  Synthesis and degradation of ketone bodies
gai00280  Valine, leucine and isoleucine degradation
gai00650  Butanoate metabolism
gai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    IMCC3135_17450 (scoB)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    IMCC3135_17450 (scoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IMCC3135_17450 (scoB)
Enzymes [BR:gai01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     IMCC3135_17450 (scoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C IF-2B
Motif
Other DBs
NCBI-ProteinID: ASJ73571
UniProt: A0A2Z2NU53
Position
complement(3973997..3974626)
Genome map
AA seq 209 aa AA seqDB search
MAWDRNQMAARAGQELQNGWYVNLGIGIPTLVSNYIPEGVEVTLQSENGMLGMGPFPTED
QIDADLINAGKQTITELPQTAYFDSAQSFGMIRGGKIAMAILGAMEVAENGDLANWMIPG
KLVKGMGGAMDLVAGVGRVVVVMDHTSKHGDSKLLKECTLPLTGKSVVDRIITNLGVLDV
VEGGLRIVECAEGVTEDELRAATEATIVA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggatcgcaatcagatggctgctcgtgccgggcaggaactgcaaaacggctgg
tacgtgaaccttggcatcggtattccgacactggtatcaaactacatcccggaaggtgtt
gaggtcacactgcagtcagaaaacggcatgctgggtatggggcctttcccaaccgaagat
caaatcgatgctgatttgatcaatgcaggcaaacagacgatcaccgaactgcctcaaacc
gcctattttgacagcgcgcagagctttggcatgatccggggcggcaaaatcgccatggct
atacttggcgcaatggaagtggctgaaaacggtgatcttgccaactggatgattccgggc
aagctggttaaaggcatgggcggcgcaatggatctggttgcaggtgttggccgagttgtt
gtcgtaatggaccacaccagcaagcatggcgatagcaagcttttgaaggaatgcacactg
ccgctgaccggtaaatccgtggttgatcgaatcattaccaacctgggtgttctggatgtc
gtagaaggtgggctgcgtattgttgaatgtgccgaaggcgtcactgaagacgaactacgg
gcagctaccgaagccactatcgtcgcttaa

DBGET integrated database retrieval system