KEGG   Granulosicoccus antarcticus: IMCC3135_18070Help
Entry
IMCC3135_18070    CDS       T04938                                 

Gene name
aldA_1
Definition
(GenBank) Lactaldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
gai  Granulosicoccus antarcticus
Pathway
gai00620  Pyruvate metabolism
gai00630  Glyoxylate and dicarboxylate metabolism
gai01100  Metabolic pathways
gai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IMCC3135_18070 (aldA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC3135_18070 (aldA_1)
Enzymes [BR:gai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     IMCC3135_18070 (aldA_1)
    1.2.1.22  lactaldehyde dehydrogenase
     IMCC3135_18070 (aldA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ASJ73693
UniProt: A0A2Z2NQS5
Position
complement(4126724..4128148)
Genome map
AA seq 474 aa AA seqDB search
MRIDQNFVNNEFVVSSQAQTLPVYNPATEELVGQVQLATAEEAIEAVQFAAAAQKHWRKL
TSVERAGYMHRLADALVARKQLIGQALADESGKSLEDACNEAVYAGDITRYHAEWARRIE
GEIVPSDTPDETLLLQREPIGVIACLIPFNYPVYTLLRKIAPALITGNTVVVRPSNNTPG
SAFEIAQAVLEAGIPAGVINILTMDHAIAEQVCTHPAVGMITLTGSVGAGRKVLEYSQVN
ICKSSLELGGKSPAIVEADADLEKAAREIVASKTTNCGQLCTAIERVYVHEAVYERFVEL
LRTHMSARQYGDRSVEPGDMGPLINESSRLNIHQMVERAIDDGAKLEMGGFIPEGPGHFY
PPTMLTNCRQEMEIVQEEIFGPVLPVLKYSDADQALQLANDHQFGLASVVYTENYRTAMK
LANNIEAGEVYVNRTPADPYQGYHAGWKRSGLGGDDGKHGMLDYTQTRLVVLNY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgaccagaactttgtcaataacgaatttgtagtgtccagtcaggcgcaaacg
ctgcctgtctataatcctgccaccgaagagctggttggtcaggtacagctggcaaccgcc
gaggaggctatcgaggctgtccagtttgcggctgcggcacaaaagcactggcgcaagctg
acaagtgtggaacgcgcaggctatatgcaccgtctggccgatgctctggtggcacgcaag
cagctgatcgggcaggcgctggctgatgagtctggcaagagcctggaggatgcttgcaat
gaggctgtatatgccggggatatcacccgttatcatgccgagtgggcacgtcggattgaa
ggggagattgttcccagtgatacccctgatgagaccctgctgttacagcgagagccgatc
ggtgtcattgcctgtctgattcccttcaactatcccgtctatactctgttgcgaaagatc
gccccagcactgattaccggtaatacggttgttgttcgacccagtaacaacacaccaggc
tcagccttcgagatcgcacaggcggtgcttgaggcaggcattcctgctggtgtgatcaat
attctgaccatggatcacgctattgccgaacaggtctgtacgcaccctgccgtaggcatg
atcacgctgaccggtagtgtgggtgcgggccgcaaggtgctggagtattcccaggtcaat
atctgcaagtcttcactggaactgggtggcaagagcccggctatcgttgaggccgatgcg
gatctggaaaaggcggcacgggagattgtggcctccaagacgactaactgcggacagctg
tgtaccgccattgaacgcgtctatgtgcatgaagcggtctatgagcgctttgtcgagcta
ctgcgcacgcatatgtcggcacgccagtatggcgatcgcagtgtagagcccggtgatatg
gggccactgatcaatgaaagctcgcgcctgaatattcatcagatggttgagcgcgcgatt
gatgatggcgcaaagcttgagatgggcggcttcattccagaagggccagggcatttctac
ccaccgacaatgctgaccaactgccgccaggaaatggagatcgtgcaggaggagatattt
ggccccgtactgccggtgctcaagtacagtgatgctgaccaggctttgcagctggccaac
gaccatcagttcggactggcctcggttgtctataccgagaactaccgtacggcgatgaag
cttgccaacaatatcgaagccggtgaggtgtatgtcaatcgcacaccggccgatccgtat
cagggctatcacgccggttggaagcgctcggggctgggtggcgatgatggcaagcacggc
atgctggactacacccagacaagactggttgttctgaattactga

DBGET integrated database retrieval system